KEGG   Amborella trichopoda: s00182p00010830Help
Entry
s00182p00010830   CDS       T02990                                 

Gene name
AMTR_s00182p00010830
Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
atr  Amborella trichopoda
Brite
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     s00182p00010830 (AMTR_s00182p00010830)
    1.3.1.94  polyprenol reductase
     s00182p00010830 (AMTR_s00182p00010830)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 359 aa AA seqDB search
MAFYNIREILSTVIFSFSVEEWSWLLVMVLRAAWIAGTLPILLSFIPFSSFVRIRNVVLG
FAKRGKLLQSSSQRFTVPQNFFLHFYLVAVVWTAALLVCTWSYAHDMTVSMASEALHFST
VASHLTGGSHIFSFDKSRSSHPELSYQIWTVVFLLLMMEAQVLRRFYESLYVFNYSSSAR
MRILGYLTGLFFYIAAPLSLCISYAPEVIRYVTQQAANYIVKGRTYMPDVKIDWLEYIKP
FVHLGLFQWIGAGIFIWGWTRQFRCHTILGSLRTQSEDDEYKIPHGDWFEFVSCAHYLAE
IILYAGILIASGGLDLTIWLVFIFVVSNLTLAALETHNWYLRKFDDYPRTRYAIIPRIV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccttctataacattagagagattttgtctactgtgattttttctttttctgtggag
gagtggtcatggcttcttgtgatggttttgagagcggcatggatagctggaaccttacct
atactgctttctttcattcccttttcttctttcgttcgtattcgaaatgtggttttaggg
tttgctaaacgagggaagcttcttcaatcttcttctcagagattcactgttccacagaac
ttcttcttgcatttttacttagtggcagttgtatggacagcagctttacttgtctgtact
tggtcctatgcacatgacatgacagtttcaatggcatcagaagcgttgcatttttcgaca
gttgctagccatttaactggaggctctcatattttttcttttgataagtcccgatcttct
catccagagctcagctatcagatatggacggttgtatttttactcttgatgatggaggct
caagtcttgaggcgcttttatgagtctttgtatgtattcaactatagttcttctgctaga
atgcgcatacttggctacttaacaggtttatttttctatatagctgcacctctatcgctt
tgcatctcttatgctccagaagtgatcagatatgtaacccagcaagctgctaattacatt
gtaaaaggtcgaacttatatgccagatgtcaagattgattggttggaatatattaagcca
tttgtacacttgggattgtttcagtggattggtgcaggcattttcatttggggatggact
cgtcagtttcgttgccacactatacttggatctctcagaacacaatcagaggatgatgaa
tataaaattccacatggcgattggtttgaatttgtctcgtgcgcacattacttggcagaa
ataatattgtatgctggaattctgattgccagtggaggattagatttgacaatttggctg
gttttcatatttgtggtatcaaacctcaccttagctgcactagaaacgcacaattggtat
ctccgcaaatttgatgactacccacgaactcgttatgccatcattccacggattgtgtag

DBGET integrated database retrieval system