KEGG   Amborella trichopoda: s00303p00012690Help
Entry
s00303p00012690   CDS       T02990                                 

Gene name
AMTR_s00303p00012690
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
atr  Amborella trichopoda
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    s00303p00012690 (AMTR_s00303p00012690)
Enzymes [BR:atr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     s00303p00012690 (AMTR_s00303p00012690)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 370 aa AA seqDB search
MSGACGITFRAPHHHCPTSQNPNSTTPKIPVFPLPINTNKRFHPLCSSASSQTQKTENKN
PLVVVGSANADIYVEIERLPKEGETVAAKRGQTLAGGKGANQAACAGMLDYHPTYFIGQV
GEDAHGRLVTDALAQGGICLEHVKRVEGEPTGHAVVMLLGSDGQNSIIIVGGANTSGWPD
PLPEEDLWVVRNAGVLLLQREIPDAVNIQVAKAANSAHVPVILDAGGMEGPIPRELLKAV
DIFSPNETELARLTGMPTDTSEQIAEGISKCHEMGVKQVLLKLGAKGSALFTEGEERPII
QPIIATSKVVDTTGAGDTFTAAFAVALVEGKSNKECLKFAAAAASLCVQVKGAIPSMPNR
KAVLELLQSL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgcgtgcgggatcacgttccgagcaccccatcaccactgccccacttcacaa
aaccctaactccaccaccccaaaaatccctgtcttccccctccccatcaataccaataag
cgtttccaccctctgtgctcatcggcttcatcacaaacccaaaaaactgaaaataagaac
cccctggtggtggtgggctcggcaaatgcagacatttatgtcgagatcgagaggctccca
aaggaaggagagactgtggctgcaaaaaggggtcaaaccctagcaggtgggaagggggcg
aaccaggctgcgtgtgccgggatgctggattaccaccccacttatttcatagggcaggtg
ggtgaggatgctcatggcagattggtgacggatgcgttggcccagggaggcatctgcttg
gagcatgtgaagagggtggagggggaacccacggggcatgccgtggtgatgctgcttgga
tctgatgggcagaattctatcatcatagttgggggggcaaacacgagtggctggccagac
cctctgccggaggaggatctttgggttgtcaggaatgcgggggtcctccttttgcagagg
gagatacctgacgccgtcaacattcaggtcgcaaaggctgcaaacagtgcacatgttccc
gtcattttggatgctggggggatggagggaccaatccctcgagaactacttaaagctgtt
gatattttcagcccaaatgagactgaattggcacgcttgacagggatgccaacggacact
tccgaacaaattgcggaaggaatttcaaaatgccatgaaatgggagtgaagcaagttttg
ttaaaacttggagcaaagggatcagcactttttacagaaggtgaggagcgtcccattata
cagccgattattgcgacctcaaaagttgttgatacaactggtgctggtgatactttcact
gctgcgtttgcggtggctctagtcgaggggaagtcgaataaggagtgcttgaaatttgca
gctgcagcagcatctctctgtgttcaagtgaagggagccatccctagcatgcctaatagg
aaggcagttttggagctgcttcaatctctttga

DBGET integrated database retrieval system