KEGG   Aegilops tauschii (wheat D): 109782543Help
Entry
109782543         CDS       T04345                                 

Gene name
LOC109782543
Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109782543 (LOC109782543)
   00500 Starch and sucrose metabolism
    109782543 (LOC109782543)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109782543 (LOC109782543)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
Unknown
AA seq 572 aa AA seqDB search
MWNPLWVLRPWLLLLLLQLAIGSMEAVAPSPPVPSFVTNPLLRTGYHFQPPKNWINDPNG
PLYYKGWYHLFYQYNPKGADWVNTLWAHSVSRDLINWNVLGLALEPSIRSDQYGVWSGSA
TILLDGTPVLVYTGINRPDTPYQVQNVAIPKNKSDPLLREWVKPDYNPIIVPDSGMNVTQ
FRDPSTAWHIDGQWRILVGGEKGSHGQAYVYRSTDFKHWVRAKHPLHSATSGMWECLDFF
PVLIQGQKGLDTSEHSGRVKYVLKSSLEKARYDYYTIGTYNSRTERYVPDDLNGDYHRLR
YDYGKFYASKTFFDPARQRRVLVGWANESDTVPDDIAKGWSGIHAIPRKIWLDPGGKQLV
QWPIEEVEQLRRKSVSVTNKVVKPRNHFEVKGLETYQADVEVSFEIPSLERAEPFDHAFS
NDAPKLCRMKGADNKGGVGPFGLWVLASANLEEKTAVFFRIFKDGHGKPVVLMCTDPSKS
SLGRDLDKPTYAGFVNSNVSSSGKISLRSLIDHSVVESFGAGGKTCIISRVYPSIAIGQN
AHLYVFNNGDVDVKVSRLKAWEMESSKMNNSA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatccgctatgggtcctccggccatggttgctactgctccttctgcagctcgcc
atcggcagcatggaggccgtggcgccctcgccgccagtgcctagcttcgtgaccaacccc
ttgctcaggacagggtaccacttccagccgcccaaaaactggattaacgatccgaatggg
ccactatactacaagggatggtaccacttgttttaccagtacaaccccaaaggtgccgat
tgggtcaatacactttgggctcactcggtttcacgcgacctcatcaactggaacgttctt
ggtttagccctcgagccaagcatccgatctgaccagtatggcgtttggtctggctccgca
acaatcctccttgatggcacaccagtgttggtgtacacagggatcaaccggccggacact
ccctaccaggtgcagaacgttgccatccccaagaacaagtccgacccgctacttagggag
tgggtcaaaccagactacaatccgattatagtgccggattcgggcatgaacgtgacacaa
tttcgtgacccgagcacggcttggcacatagatggccaatggcgcatactcgtaggtgga
gagaagggctcccatggtcaggcatatgtgtatcggagcaccgacttcaagcattgggtt
cgagccaagcacccacttcactcggcaaccagcggtatgtgggagtgcctcgacttcttt
ccggtgctcatacaagggcagaaaggtctcgacacatccgagcatagtggcagagtcaag
tatgtactcaagagtagcctcgagaaggctcggtatgactactacaccatcggaacctat
aatagtaggacagagcgttatgtgcctgacgatctaaatggtgactaccaccgcctccgc
tacgactatgggaaattctatgcgtccaagacattcttcgaccccgcaaggcagagacgg
gtccttgtaggatgggccaatgagtcagacaccgttccagacgacatcgccaagggttgg
tccggcattcatgcaatcccaaggaagatatggcttgaccccggtggcaagcagctcgtg
cagtggcccattgaggaggtcgagcagctgaggcgtaagtctgttagtgtaacaaacaag
gtcgtgaagcctaggaatcattttgaggttaaaggcctggagacttaccaggctgatgtg
gaggtgagtttcgagataccaagcctggaaagggccgagccgttcgatcatgcattctcg
aacgatgctccgaagctgtgtagaatgaagggtgcggacaataagggcggagtaggtccc
tttggtttgtgggtgctagcatctgccaacttggaggagaagactgcggttttcttcagg
attttcaaggatgggcatggcaagccagtggtcctgatgtgcactgaccctagcaagtca
tctcttggtcgtgatcttgacaagccaacttatgccgggtttgtcaactccaacgtttca
tcatccggcaagatctctttgagaagcttgattgatcattcagtcgttgagagctttggt
gccggaggcaagacctgcatcatatcaagggtgtacccatccatcgccatagggcaaaac
gctcatctttacgtcttcaacaatggagatgtggatgtcaaggtgtcgcgcctcaaggcc
tgggagatggagagttccaagatgaataatagtgcttaa

DBGET integrated database retrieval system