KEGG   Agrobacterium fabrum: Atu0018Help
Entry
Atu0018           CDS       T00070                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
atu  Agrobacterium fabrum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Atu0018 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Atu0018 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Atu0018 (trpB)
Enzymes [BR:atu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Atu0018 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15139..16359
Genome map
AA seq 406 aa AA seqDB search
MNDAPTPNSFRAGPDEDGRFGIYGGRFVAETLMPLILDLQAEWDKAKSDPEFQAELKYLG
THYTGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCLGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVARQAPNVFRMKLLGAEVKPVTAGHGTLKD
AMNEALRDWVTNVDDTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKAQMLEAEGRLPDMII
AAVGGGSNAIGIFHPFLDDKNVRIVGVEAGGKGLSGEEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHSWLNDIGRVEYVPIMDHEALDAFQMLTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDVHTVSKFLGMDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacgcgccaacacccaattcttttcgtgctggtcccgatgaggacggacgcttc
ggcatttacggaggacgcttcgttgccgaaacgctgatgccgcttatcctggatttgcag
gcggaatgggataaggccaagagcgatcccgagtttcaggccgaactaaaatatctcggc
acgcattacaccggccgcccgagcccgctttatttcgcggagcgtctcacggcggaactt
ggcggcgcgaagatttatttcaagcgcgaagagttgaaccatactggctcgcacaagatc
aacaattgcctcggccagatcctgcttgccaagcgcatgggcaagacccgcatcattgcc
gaaaccggtgcgggccagcacggcgttgcctcggccacggttgctgcacgtttcggcctg
ccttgcgtggtttatatgggcgccactgatgtcgcccgtcaggccccgaacgtatttcgc
atgaagcttctcggcgccgaggtaaagccggtcacggccggccatggcacgctcaaggac
gccatgaacgaggcactgcgtgactgggtcaccaatgtcgacgatacctattacctgatt
ggcaccgcagccggcccgcatccctatccggaaatggtccgtgatttccaggcggttatc
ggcgaggaagccaaggcgcagatgctggaggcggaaggccgcctgccggatatgatcatt
gccgctgtcggcggcgggtcgaacgccatcggcatcttccatccgttcctcgatgacaag
aatgtccgtatcgtcggcgtcgaagccggcggcaagggcctgtctggcgaagaacactgc
gcctcgatcacagccggttcaccgggcgtgctgcatggcaaccgcacctatctgcttcag
gacggtgatggccagatcaaggaaggtcattcgatctccgcaggcctcgattatcccggc
atcgggccagagcattcctggctgaacgatatcggccgcgtcgaatatgtgccgatcatg
gaccatgaggcattggacgccttccagatgttgacccgcctcgaagggatcattccggct
ctggagccaagccacgcgctggccgaagtcatcaagcgcgcgccgaaaatgggcaaggat
gaaatcatcctgatgaacctctccggccgtggcgacaaagatgtccacaccgtcagcaag
ttccttggaatggatgtataa

DBGET integrated database retrieval system