KEGG   Agrobacterium fabrum: Atu0019Help
Entry
Atu0019           CDS       T00070                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
atu  Agrobacterium fabrum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Atu0019 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Atu0019 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Atu0019 (trpA)
Enzymes [BR:atu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Atu0019 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16364..17203
Genome map
AA seq 279 aa AA seqDB search
MTVRMDKRFADLRAENRPALITYFMGGDPDFQTSLGIMKALPEAGADVIELGMPFSDPMA
DGPAIQLAGQRALKGGQTLKTTLDLAREFRKQDNATPIVMMGYYNPIYIYGVEKFLDDAI
ASGIDGLIVVDLPPEMDDELCIPALARGINFIRLATPTTDGKRLPAVLKNTSGFVYYVSM
NGITGSALPDPSLISGAVGRIKAHTELPVCVGFGVKTADHAKAIGAVADGVVVGSAIVNQ
IAGSLTKDGQATADTVPAVTTLVKGLSTGVRASRLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactgtacgtatggacaagcgctttgccgatctgcgggctgaaaatcgccccgccctg
atcacctatttcatgggcggcgacccggatttccagacctcgcttggcatcatgaaggcc
ctgccggaagcaggcgccgacgttatcgaactcggcatgccgttttccgatcccatggcg
gatggcccggccattcagctggccggccagcgcgcgctgaagggtggacagacactgaag
accacgctcgatctcgcccgcgagttccgcaagcaggacaatgcaacgccgatcgtgatg
atgggctattataatccgatctatatctatggcgttgaaaagtttctggacgacgcaatt
gccagtggcattgatggccttatcgtggtcgacctgccgccggaaatggacgatgaactc
tgcattccggcgcttgcgcgcggcatcaatttcatccgtctggcgacgccgaccacggat
ggcaagcgcctgccggccgtccttaaaaatacctcaggtttcgtgtattacgtctcgatg
aacggtatcaccggttcagcacttcccgatccctcgttgatctcgggcgctgtcggtcgt
atcaaggcgcatacggaactgccggtttgtgtcggttttggcgtcaagacggccgatcat
gcgaaggcgatcggtgccgtagcggatggtgtggtggtgggttcagccatcgtcaaccag
attgcgggcagcctgaccaaggacgggcaggcgaccgccgacactgtgccggcagttacg
acgctggtaaaaggactttcaacgggcgtgcgtgcatcgcgcctcgccgctgcggaataa

DBGET integrated database retrieval system