KEGG   Agrobacterium fabrum: Atu0047Help
Entry
Atu0047           CDS       T00070                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
atu  Agrobacterium fabrum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Atu0047 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Atu0047 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    Atu0047 (glcB)
Enzymes [BR:atu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Atu0047 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
47736..49970
Genome map
AA seq 744 aa AA seqDB search
MPRLTSDRLSVQSMPSEYKEAHVSRTDKFGLSIDDRLYAFLTDEVLPGTGLDSETFFEGF
SAIVHELSPKNRELLAKRDALQEKIDGWYRENGAPSDFDAYEAFLKEIGYLLPEGPGFKV
ETNNVDPEIAVVAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAISDADGAEKGRGY
NPKRGDKVIAWARNFLDESAPLETGSWSDVTGFNIADGLLQLAIGAATTGLKDAVQFKGF
SGEAAKPATILLGKNGLHTEIVIDPSTEIGKSDRAGISDVILESALTTIMDCEDSVAAVD
AEDKVLVYGNWLGLMRGDLTEAVSKGGNTFTRRLNPDRYYTAPDGSALTLPGRSLMLVRN
VGHLMTNPAILDRDGRDVPEGIMDAVVTALIALYDVGPSGRRQNSRAGSMYVVKPKMHGP
EEVAFANEIFARVENLVGMAPNTMKMGIMDEERRTTVNLKESIRAAKDRVVFINTGFLDR
TGDEIHTSMEAGPMIRKGDMKQAAWIAAYENWNVDIGLECGLSGHAQIGKGMWAMPDLMA
AMLEQKIAHPKAGANTAWVPSPTAATLHATHYHKVDVAAVQEGLKSRGRAKLSDILSVPV
APRPNWTPEEIQRELDNNAQGILGYVVRWVDQGVGCSKVPDINNIGLMEDRATLRISAQH
MANWLRHGVVTEAQIIKTMKRMAAVVDTQNAGDPAYLPMASDFDGSVAFQAAVELVLKGR
EQPNGYTEPVLHRRRLELKAKQAG
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgattgacgagcgaccgcctcagcgtccaatctatgccttcagaatataaggag
gcgcatgtgagccgcacggataaattcggtctttccattgacgacaggctgtatgccttt
ttgacggacgaggtgcttccgggcacaggtctggacagcgagaccttctttgagggtttt
tcggccatcgtccatgagctttctccgaagaatcgtgaactgcttgccaagcgcgatgcg
ctgcaggaaaaaatcgatggttggtaccgtgagaacggcgctccctcggatttcgatgcc
tatgaggccttcctgaaggagatcggctacctgctgccggaaggtcccggcttcaaggtc
gaaactaataatgtcgacccggaaattgccgtcgtcgccggtccgcaactcgttgttccc
gtcatgaatgcgcgttatgcgctgaacgccgccaatgcccgctggggttcgctttatgat
gcgctctacggcacagacgccatttccgatgccgacggtgcggaaaagggcaggggttac
aatccgaagcgtggtgacaaggtcatcgcttgggcgcgcaatttcctcgatgaatccgcc
ccgctcgagacaggaagctggtccgacgtcacaggcttcaatattgctgacggcctgttg
cagcttgccatcggtgctgccacgactggcctcaaggatgcagttcaattcaaaggtttc
agcggtgaagcggcaaagcccgccacgatcctgctcggcaagaacggtctgcacacggaa
atcgtcatcgatccctcgaccgaaatcggcaaaagcgatagagcaggcatatcggacgtc
attctcgaatcagcgctgacgaccatcatggattgcgaggattctgtcgccgccgtcgat
gccgaggacaaggtgctggtttacggcaactggcttggcctgatgcgcggcgatttgacg
gaagccgtctccaagggcggcaacactttcacccgccgcctcaacccggatcgttattat
accgctcccgatggttccgcgctcacgctgccgggccgttccctgatgctggtgcgcaat
gtcggtcatctcatgaccaatccggcgatcctcgacagggatggccgcgacgtgccggaa
ggcattatggatgccgtcgtcacggcgctgatcgcgctttacgatgtcggcccgtccgga
cgacgccagaattcccgcgccggctccatgtatgtcgtcaagccgaagatgcacggaccg
gaagaggttgctttcgccaacgagatattcgcccgcgtcgaaaatcttgtgggcatggcg
ccgaacaccatgaaaatgggcatcatggatgaggagcgccgcaccaccgtcaacctcaag
gaaagcattcgcgcggcgaaggatcgcgtagtcttcatcaataccggcttcctcgatcgc
accggcgacgaaatccatacctctatggaagcaggcccgatgatccgcaagggcgacatg
aaacaggctgcatggatcgcggcttatgaaaactggaacgtcgatattggcctcgaatgc
ggtctctccggccacgcccagatcggcaagggcatgtgggccatgccggatctgatggct
gccatgctggagcagaagatcgcgcatccgaaagccggcgccaataccgcctgggtgccg
tcgccgacggcggcgacgttgcacgccacgcattaccataaggtcgacgtcgcagccgtt
caggaaggcctgaaaagccgcggtcgcgcaaagctctccgatatcctgtcggtgccggtc
gcaccgcgtcccaactggacgccggaggaaatccagcgcgagcttgataataacgcccag
ggcattctcggttatgttgttcgctgggtcgatcagggtgtcggctgctccaaggtgcct
gacatcaacaatattggcctgatggaggaccgcgccacgctgcgcatttccgcccagcac
atggcgaactggctgcgccacggcgtggtgacggaggcccagatcatcaagaccatgaag
cgcatggccgcggtagtggacacgcagaatgccggcgatccggcctatctgccgatggca
tcggatttcgatggatcggtggctttccaggctgctgtcgagctggtgctgaagggccgt
gaacagccgaacggctacaccgaaccggttctgcaccgccgccgtctggagctgaaagca
aagcaggcgggctga

DBGET integrated database retrieval system