KEGG   Agrobacterium tumefaciens C58: Atu0093Help
Entry
Atu0093           CDS       T00070                                 

Gene name
recR
Definition
Recombination protein
Orthology
K06187  
recombination protein RecR
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:atu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97808..98413)
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKEQLLGPLGHAMGEAYDKVKIC
SCCGNVDTIDPCTVCADDRRDQSVIIVVEDVSDLWALERAGAMNTAYHVLGGTLSPLDGV
GPEDLNIKGLIDRVSAGGIRELIIAVNATVEGQATAHYITDRLSGLGIKITRLAHGVPVG
GELDYLDEGTLTAALRARTTI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgagtcaccggtcccgaaattgaaaaactgatccagcttctggcaaaagtg
ccggggcttggcccccgctcggcgcggcgggcggcattgcatctcatcaagaagaaagaa
cagcttctcgggccgctcggccatgccatgggcgaagcctatgacaaggtgaagatctgc
tcctgctgcggcaatgtcgatacgatcgatccctgcactgtctgcgccgatgaccggcgt
gaccagtccgtcatcatcgtggtggaagacgtgtcggatctctgggcactggagcgggcg
ggcgcgatgaacacagcctatcacgttctgggtggcacactgtcaccgctcgatggcgtc
ggaccggaggacctgaacatcaagggcctgatcgaccgcgtgagtgctggcggcattcgc
gagctcatcatcgccgtcaatgcgacggtggaaggacaggcgactgcccattacatcaca
gaccgcctctccggcctcggcatcaagatcacgaggctcgcccatggcgtgcctgtgggc
ggtgagcttgattatctcgacgagggcacattgacggcggcgcttcgggcgcgaacgacg
atctga

DBGET integrated database retrieval system