KEGG   Agrobacterium tumefaciens C58: Atu0101Help
Entry
Atu0101           CDS       T00070                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:atu00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:atu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
104797..105375
Genome map
AA seq 192 aa AA seqDB search
MNSYVNMGVGALLGTVFVLMSVSIASEGIFHAPAPEKEGYTIVAAESGGGEAGGGEAAAA
ATPIAKLLASADAAKGEAVFKKCTSCHTGESGGANKVGPNLFDVVNRPIASHEGFSYSAG
MKDFSKGASVHWDYDHLNYFLEAPKKHVPGTAMGFAGVKKETERADLIAYLRSLSANPAP
LPDPNAAPAPMN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttatgttaatatgggcgttggggcgttgctgggcacggttttcgtcctgatg
tcggtgtcgattgcgtctgagggcatttttcatgcgcctgcgcccgaaaaggaaggttac
accattgttgcggcagaaagcggcggtggtgaagccggtggcggagaagccgctgcagcc
gcgacgccgatcgcaaaattgcttgcgagcgccgatgccgccaagggtgaagcggtcttc
aagaagtgtacgagctgtcataccggagagagtggtggtgcaaacaaggtcggccccaat
ctcttcgatgtcgtcaaccggccgatcgccagccacgaaggtttcagctactccgctggg
atgaaggatttctccaagggtgcttccgtgcattgggattacgatcatctcaactacttc
ctcgaagcccccaagaaacacgttcccggcacggccatgggatttgcgggtgtgaagaag
gaaacggaaagagccgacctcatcgcttatctgcgctcactttcggcaaacccggctccg
cttccggatccgaatgcggctcccgcaccgatgaactga

DBGET integrated database retrieval system