KEGG   Agrobacterium fabrum: Atu0184Help
Entry
Atu0184           CDS       T00070                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
atu  Agrobacterium fabrum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Atu0184 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu0184 (glk)
   00052 Galactose metabolism
    Atu0184 (glk)
   00500 Starch and sucrose metabolism
    Atu0184 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Atu0184 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Atu0184 (glk)
   00524 Butirosin and neomycin biosynthesis
    Atu0184 (glk)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Atu0184 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(186737..187759)
Genome map
AA seq 340 aa AA seqDB search
MPKTSDTEYLSFPILLGDIGGTNARFSILIDSFAEPVHLTTVKTAEYPGIDDAIQQAVLD
KTSLQPVSTILAIAGPIEGDEIPLTNCHWVVKPKDMLAKLGLKDVIVINDFEAQALAIAA
LDDDNREPIGSGKKDMLASRVVLGPGTGLGVAGLVYARHMWFPVPGEGGHIDIGPRSARD
YVVFPHIETIEGRVAGEQILCGRGLVNLYRAICKADGIEPVFSDPADITSQGLSGQNAQA
KETLSLFSTYLGRVAGDLALIFMAKGGVYLAGGISQKIIPALKSPEFRAAFEDKAPHSAL
MRTIPTFVVTHPQAALSGLATYARTPADFGLALDGRRWRA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagacgtccgataccgaatatctgtcctttccgatccttcttggcgacatcggc
ggcaccaatgcccgcttttccatcctgatcgattcctttgctgaaccggtgcacctcacc
acggtgaagacggcggaatatcctggtatcgatgacgcgatccagcaggcggttctggac
aagacctctcttcagccggtctcgaccattcttgcaattgccggcccgatcgaaggcgac
gagattccgttgaccaactgccactgggtcgtcaagccgaaggacatgctggccaagctc
ggcctgaaggacgtcatcgtcatcaacgactttgaggcgcaggctctggcgattgcggct
cttgacgacgacaaccgggagcctatcggctccggtaaaaaggacatgctggcgtcgcgc
gtcgttcttggaccgggcacggggcttggcgtcgccgggctggtctatgcccgccatatg
tggtttccggtgcctggcgaaggcgggcatatcgatatcggcccgagaagcgcgcgcgac
tatgtggttttcccccatatcgaaaccatcgagggccgcgtcgccggcgaacagatcctg
tgcggacgcgggctggtcaatctttatcgggccatctgcaaagccgacggcatcgagcct
gtcttttccgatccggccgacatcacctcgcaggggctttcgggccagaacgcgcaggca
aaagaaacgctgtcgctgttcagcacctatctcggccgcgtggcgggcgaccttgcgctg
atcttcatggccaagggcggcgtttatctggccggcggtatttcgcagaagatcatccct
gcgctgaagagcccggaattccgggcggcgttcgaagacaaggcgccgcacagcgctctg
atgcggaccattccgacattcgtcgtcacccatcctcaggcggccctttccggcctcgcc
acctatgcgagaacgcctgccgatttcggtcttgcgctggacgggcggcgctggagggct
tga

DBGET integrated database retrieval system