KEGG   Agrobacterium fabrum: Atu0322Help
Entry
Atu0322           CDS       T00070                                 

Gene name
fadB
Definition
enoyl CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
atu  Agrobacterium fabrum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Atu0322 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Atu0322 (fadB)
   00650 Butanoate metabolism
    Atu0322 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Atu0322 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Atu0322 (fadB)
   00310 Lysine degradation
    Atu0322 (fadB)
   00360 Phenylalanine metabolism
    Atu0322 (fadB)
   00380 Tryptophan metabolism
    Atu0322 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Atu0322 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Atu0322 (fadB)
   00281 Geraniol degradation
    Atu0322 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Atu0322 (fadB)
   00627 Aminobenzoate degradation
    Atu0322 (fadB)
   00930 Caprolactam degradation
    Atu0322 (fadB)
Enzymes [BR:atu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Atu0322 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315554..316315
Genome map
AA seq 253 aa AA seqDB search
MILVEKRDEVGVITLNRPKVLNALNSVLLKELRHILSSFSADDSIGAIIITGSEKAFAAG
ADIKEMQGLDFVDAYVGDFLGGWDEVAATRKPVIAAVSGFALGGGCELAMMCDFIIASDT
AKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLVLTGRMMDAAEAERAGLVSRIVPAAD
LMEVAVEAATRIASLSRASVLMAKESVNRSFEVPLAEGLRYERRAFQSLFATEDQKEGMA
AFVEKRKPAFRNR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatactggtcgagaagcgcgatgaggtgggcgtcatcacgctcaaccgccccaaggtg
ctcaacgccctcaattcggtgcttctgaaagagctgcggcacattctgtcttctttctca
gccgatgattccatcggcgccatcatcatcaccggctcggaaaaggcatttgcggccggc
gccgacatcaaggaaatgcaggggctggatttcgtcgatgcctatgtgggcgatttcctg
ggtggctgggatgaggttgcggccacacgcaagcctgttattgccgctgtttccggtttt
gcgctcggcggcggctgcgagctggcgatgatgtgcgatttcattatcgcttcggacacg
gcgaagttcggccagccggaaatcaccctcggcgtcattcccggcatgggcggatcgcag
cggctgacgcgggcggtgggcaaggcgaaggccatggacctcgttctgaccggccgcatg
atggatgcggcggaagccgagcgcgccggcctcgtatcgcgtatcgtgccggctgcagat
ctcatggaggtggcggtggaagctgcgacccgcattgcctcgctgtcgcgtgcttccgtg
ctcatggccaaggaaagcgtcaaccgctccttcgaggtgccgctcgccgaggggctgaga
tatgaacggcgtgccttccagtcgctctttgcgacggaggatcagaaggagggcatggcg
gccttcgttgaaaagcgcaaacccgctttccggaatcgctaa

DBGET integrated database retrieval system