KEGG   Agrobacterium fabrum: Atu0364Help
Entry
Atu0364           CDS       T00070                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
atu  Agrobacterium fabrum
Pathway
atu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Atu0364 (rbsK)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Atu0364 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 1132402
NCBI-ProteinID: NP_353396
UniProt: A9CKC7
Position
circular:complement(358549..359448)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALAARRAGVTVKMAGATG
DDTFAAPALTLLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSAFDAT
KVVGEMDAGDILMLQFEIPAAAIEAALTAAKAKRITTVINTAPLTADGPRLAGLADIVIA
NETEFELLIGKNGLSSGERESELKALHDRTGQTLIVTLGADGVIAMRNGKVFSASGLKIE
PVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLACTRAGAQPSIPQAAEVDAAL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgattactgttttcggctccatcaacatggacctcgtcgccaccgccaaacgcctgccc
aagcccggtgaaaccgtgaccggagacaccttctccacggccgccggcggcaagggagcc
aatcaggcgctggccgcacggcgtgcaggtgttacggtgaagatggccggcgctacgggt
gatgatacctttgccgcgccggcgctgaccttgctgcgcgacgcgggtaccgatctgtca
ttggtgaaaaccgcgcccggcccgacgggaacggcagtgatcctcatcggtgaaggcgga
gagaacatgatctcggtcattcccgcagcaaatggcgaagtctccgcattcgacgcgaca
aaggtcgtgggcgagatggacgcaggcgatattctgatgctgcagttcgaaataccggct
gcagccatcgaagcggcgctgacggctgcaaaggcaaagcgcatcaccaccgtcatcaat
accgcaccgctgactgcagatggtccccgccttgccggccttgccgatatcgtcatcgcc
aacgaaaccgagtttgagttgctgatcggcaagaacggcctctccagtggcgaacgagag
agcgaactcaaggcccttcacgacaggaccggccagactttgatcgtcacgcttggtgca
gatggcgtgatcgccatgcgcaacggcaaggttttcagtgcttccggcctgaagatcgag
ccggtcgacacggttggtgcgggcgataccttctgtggttatcttgccgccagccttgat
cagggaatggatttcgaaaaggcgctgaagcgcgccgccgttgcaggttcactcgcctgc
acgcgcgccggcgcccagccttccattccgcaggcagcggaagtggatgcggcgctctga

DBGET integrated database retrieval system