KEGG   Agrobacterium fabrum: Atu0503Help
Entry
Atu0503           CDS       T00070                                 

Gene name
fadB
Definition
enoyl-CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
atu  Agrobacterium fabrum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Atu0503 (fadB)
   01212 Fatty acid metabolism
    Atu0503 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Atu0503 (fadB)
   00650 Butanoate metabolism
    Atu0503 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Atu0503 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Atu0503 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Atu0503 (fadB)
   00310 Lysine degradation
    Atu0503 (fadB)
   00380 Tryptophan metabolism
    Atu0503 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Atu0503 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Atu0503 (fadB)
   00281 Geraniol degradation
    Atu0503 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Atu0503 (fadB)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Atu0503 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Atu0503 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Atu0503 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493225..495441
Genome map
AA seq 738 aa AA seqDB search
MSTYTNFTIETDADGIALVTWDMPEKSMNVFTAEVLEELNAIVDATVADGAVKGVVFTSG
KSSFSGGADLSMLKSMFALYNDEKAKSPDAAAAKLFELVGRMTGLFRKIETNGKPWVSAI
NGTCMGGAFELSLACHGRVASSAKSLKIALPEVKVGIFPGAGGTQRVSRLTDAQSALQMM
TTGQSLTGARAKAMGLVHQVVEPDQLVATAKQMIKDGLKPVAPWDEKGFKAPGGGIWTPA
AAQLWPAAPAILRRESAGNYPAALAILKCVYEGLQLPFDTALKVEQRYFTEILRSKEAFG
MIRSLFISMQELNKGARRPAGQPKTEFKKVGVVGAGFMGAAVAYVTAAAGIPVTLVDRDQ
DAADKGKGHCEESVKAAIGKGRLTQEEGKALLDLVTPTSDYATLADADLVIEAVFEDRDV
KKAVIEAVEAVLPEGAIFASNTSTLPITGLAKNSKRPADFIGIHFFSPVEKMMLTEVILG
KETGDKALAVALDYVAKIRKTPIVVNDTRGFFVNRCVLRYMAESYDMLIEGVPAAMIENA
AKFAGMPVGPLALNDEVAIDLSYKILKATVADLGEKAVDPRHMELVKKLVEGDGRFGRKN
AKGFYDYPPKPAKKSLWPGLKDLYPQQKPEDVDMDVLKQRFLVTVALEAARTVEEGIVTD
PREADVGSILGFGFAPYTGGALSYIDGMGVKNFVALAEKLSEAYGPRFQPTPLLKDMAAK
GETFYGRFDPYASAAKAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttataccaatttcaccatcgagacggacgcagacggcattgccctcgtcacc
tgggacatgccggaaaaatccatgaacgtcttcacggcagaggttcttgaggaactgaac
gccattgtcgatgccaccgttgccgatggcgcggttaagggtgtcgtcttcacttcgggc
aaaagcagcttttccggcggtgccgatctgtcgatgctgaagtccatgttcgccctttat
aatgacgaaaaggcgaaaagccccgacgctgccgcggcgaagctgttcgaactcgtcggt
cgcatgacgggcctgttccgcaagatcgagaccaatggcaagccgtgggtctcggccatc
aacggcacctgcatgggtggcgcatttgagctttcgcttgcctgccatggccgcgtggcc
tccagtgccaagagcctcaagatcgcactgccggaagtcaaggtcggcatcttccccggt
gccggcggtacccaacgcgtatcgcgcctgaccgacgcgcaatcggcgttgcagatgatg
acgacagggcaatccctgaccggcgcgcgcgccaaggccatggggctggtgcaccaggtg
gtcgagccggatcaactggtcgcaaccgcaaagcagatgatcaaggacggcctgaagccg
gtggcaccctgggatgagaagggcttcaaggcccccggcggcggcatctggacgccggcc
gcagcccagctctggcctgccgctcccgccatcctgcgccgcgaaagcgccggcaactac
ccggctgcacttgccatcctgaaatgtgtttatgaaggcctgcaattgcccttcgacacg
gcgttgaaggtggagcagcgttatttcaccgaaatccttcgctcgaaggaagccttcggc
atgatccgctcgctgttcatttccatgcaggaactgaacaagggtgcgcgccgcccggca
ggccagccgaagacggagttcaagaaggtcggcgtcgtcggcgcgggcttcatgggcgct
gccgtggcttacgtcaccgccgcagccggcattcccgtgacgctggtggatcgtgaccag
gacgcggccgacaagggcaagggccattgcgaggagagtgtgaaggccgccatcggcaag
ggcaggctgacgcaggaagagggtaaggccctgctcgacctcgttaccccgacatccgat
tacgccacactcgccgatgccgatctcgtcatcgaagccgtcttcgaggatcgtgacgtg
aagaaggccgtcatcgaggccgtggaagccgtgttgcccgaaggtgcgatctttgcctcc
aacacctccactttgccaatcacgggcctcgcgaagaactcgaagcgcccggcggatttc
atcggcatccatttcttctcgccggtcgagaagatgatgctgacggaagtgatcctcggc
aaggaaaccggtgacaaggcgctggccgtcgcgctggattacgtggcgaagatcaggaaa
acgccgatcgtggtcaacgatacgcgcggtttcttcgtcaatcgctgcgtgctgcgctat
atggcggaaagctacgacatgctgatcgaaggcgtgcccgccgccatgatcgaaaatgcc
gcgaaatttgccggcatgccggtcggtccactggcgctgaatgacgaggtggcgatcgat
ctttcctacaagatcctgaaagccactgtcgccgatctcggcgaaaaggccgtcgatccg
cgtcatatggaactggtgaagaagctggtggaaggcgacggccgctttggccgcaagaac
gccaagggcttttacgactacccgccaaagcccgccaagaaatccctctggcccggcctg
aaggacctctatccgcagcagaagcctgaagacgtggatatggatgtgctgaaacagcgc
ttcctcgtcaccgtggcgctcgaagccgcccgcacggtggaagaaggcatcgtcaccgat
ccgcgtgaggcggatgtcggctccatcctcggtttcggcttcgcgccctataccggcggt
gcgctgtcctacatcgacggcatgggcgtgaagaatttcgtcgctctggccgagaagctc
agcgaagcctatggcccgcgcttccagccgacgccgctcctgaaggacatggcggccaag
ggcgagaccttctacggtcgcttcgacccctatgccagcgccgcgaaggcggcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system