KEGG   Agrobacterium tumefaciens C58: Atu0537Help
Entry
Atu0537           CDS       T00070                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:atu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:atu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(527870..529168)
Genome map
AA seq 432 aa AA seqDB search
MAIWLERASADFEQKFAAFLTTKREVSEDVNATVRDIINDVRHRGDAALAHYSQKFDGID
FTRVSMRVTADEIDAAFSAVDRAVIEALELAARRIEKHHARQMPKDDIYEDDIGVGLGSR
WTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVERIVMVVPANGGAVNPAVLAAARIAG
VEEIYRIGGAQAVAALAYGTETIAPVAKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEVL
VIADKDNDPDWLAADLLAQAEHDRGAQSILITDNADLGKAVGAAVERQLKLLSRSETAAA
SWADFGAIILVEKLTDAIPLANRIAAEHLELAVDDPDALMAHIRNAGAIFVGRHTPEVIG
DYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPEQLRQLAPAAITLAHSEGLDAH
ARSVSIRLNPES
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggcaatctggctggagcgggcatcggctgatttcgaacagaaattcgctgccttcctg
acaaccaagagagaagtttccgaagacgtcaacgcgacggttcgcgacatcatcaacgat
gtccgtcatcgcggcgatgcggcccttgcccattattcccagaaattcgacggcattgat
tttaccagggtttcgatgcgcgtgacggcggatgaaatcgacgccgcgttttcggcagtc
gacagggccgtcatcgaggcgcttgaactcgcagcccggcgtatcgaaaaacaccatgcg
cggcagatgccgaaggatgacatctacgaggacgatatcggcgtgggcctcggctcgcgc
tggaccgccatcgaggccgtggggctttatgtacccggcggcacggcgagctacccgagc
tcggtgctgatgaatgccgtaccggcaaaggtcgccggcgtggagcgtatcgtcatggtc
gtgccggccaatggcggtgcggtcaatcccgcggtactcgctgcggcacgtattgcaggc
gtcgaggaaatctaccgtattggtggcgcacaggctgtcgccgcacttgcctatggcacg
gagaccatcgcgccggtcgccaagatcgtcggcccgggcaatgcctatgtggcggccgcc
aagcggcaggtcttcggcactgtcggtatcgatatgatcgccggaccttccgaagtgctt
gttattgccgacaaggacaatgatcccgactggctggccgccgatcttctggcgcaggcg
gagcatgatcgcggtgcccaatccattctcatcaccgataatgccgacctcggcaaggcg
gtgggggcagccgtcgagcggcagctgaagcttctttcgcgttccgagacggcggcggcc
agctgggccgatttcggcgcgatcattctggtcgaaaaactcaccgacgccattccgctc
gccaaccgcattgccgccgagcatctggagcttgccgtcgatgacccggatgccttgatg
gcccacatccgcaatgccggggcgattttcgtcgggcgtcatacccctgaggtgatcggc
gattatgtcggcggttccaaccacgttttgccgacggcacgctcggctcgcttctcctcc
ggcctttcggtgctggatttcgtcaagcgcacgtcgatcctgcggctcgggcccgagcag
ttgcgccagcttgcgccggcggcgatcacccttgcccactcggaggggctggacgcgcat
gcgcgctcggtctccattcgcctcaatccggaaagttaa

DBGET integrated database retrieval system