KEGG   Agrobacterium tumefaciens C58: Atu0539Help
Entry
Atu0539           CDS       T00070                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:atu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:atu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(529856..531148)
Genome map
AA seq 430 aa AA seqDB search
MDRIRITGGNKLNGVIPISGAKNAALPLMIASLLTSDTLTLENVPHLADVEQLIRILGNH
GVDISVNGRRESQGEAYSRTVHFTCRTIVDTTAPYELVSKMRASFWVIGPLLAREGRARV
SLPGGCAIGTRPVDLFIEGLQALGATMEIDGGYINASAPKGGLIGAVYTFPKVSVGATHV
MLMAASLARGTTVIHNAAREPEVVDLAHCLIAMGAKIEGAGTSTITIEGVTSLSGARHRV
LPDRIETGTYAMAVAMAGGDVVLEGTRASLLDNALDTLRLAGVTISDTDTGLRVVRNGNG
IQPVDIVTEPFPGFPTDLQAQFMALMTRSQGVSHITETIFENRFMHVQELARLGAKISLS
GQMARIEGVTRLKGAPVMATDLRASVSLVIAGLVAEGETMVSRVYHLDRGFERLEEKLTR
CGALVERVSD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcatcagaattacgggtggcaacaagctcaacggcgtcatccccatctccggc
gccaaaaacgccgccttgccgttgatgatcgcttcgcttctgaccagcgacacgctgacg
ctcgaaaacgtcccgcatttggctgacgtggagcagctcatccgcattctcggcaatcat
ggcgtcgatatttccgtcaatggtcgtcgcgaaagccagggcgaggcctattcccgcacc
gtacatttcacctgccgtaccattgttgacacgacagccccttacgagctggtctccaag
atgcgcgcgagcttctgggtcatcggcccgcttctggcgcgtgagggccgcgcccgcgtt
tccctgcccggcggctgcgccatcggcacgcgcccggtcgaccttttcatcgagggcctg
caggcgcttggtgcgacgatggagatcgatggcggctacatcaatgccagcgcccccaag
ggtggcctcatcggcgctgtctacaccttcccgaaagtgtcagtcggcgcgacgcatgtg
atgctgatggcagcaagccttgcccgcggcaccaccgtcatccacaacgctgcccgcgag
ccggaagtggtcgatctcgcgcactgcctgatcgccatgggcgccaagatcgaaggcgcc
ggcacctccaccatcaccattgagggcgtcacttcgctctccggcgcgcgccaccgggtt
ctgcccgatcgtatcgaaaccggcacctatgccatggcggtcgccatggccggaggtgac
gtggtgctggaaggcacgcgcgcatcgctgctcgacaatgcgctcgacacgctgcggctg
gcaggcgtcacgatcagtgacaccgatacaggactgcgcgtcgtgcgcaacggcaacggc
attcaaccggtcgatatcgtcaccgagcccttccccggcttcccgaccgatctgcaggcg
cagttcatggcgctgatgacgcgttcgcagggcgtctcgcacattaccgagaccatcttc
gaaaaccgcttcatgcatgtgcaggaactggcccgtctcggcgccaaaatttcgctctcc
ggccagatggctcgcatcgaaggcgttacccgcctcaagggtgcgccggtcatggcgacc
gatctgcgcgcctcggtgtcgctggtcattgcgggcctcgtggcagaaggcgagaccatg
gtttcgcgcgtctatcacctcgaccgcggtttcgaacgcctcgaagaaaagcttacccgt
tgcggcgcactggttgaacgcgtcagcgattga

DBGET integrated database retrieval system