KEGG   Agrobacterium fabrum: Atu0607Help
Entry
Atu0607           CDS       T00070                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
atu  Agrobacterium fabrum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Atu0607 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Atu0607 (aceA)
Enzymes [BR:atu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Atu0607 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(593283..594572)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPGAPKGRFDGIERTYTAADVARLRGSVEIRHSLAEMGANRLWKLINEENFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELAKRINRT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLTAARLAADVMGVPTLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVKNGLEPCIARAVAYAPYCDLIWCETSKPDLEQARRFAEGVHKV
HPGKKLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNFGMFELARG
YKDRQMAAYSELQEAEFAAEVNGYTATKHQREVGTGYFDAVSLAISGGTSSTTAMKESTE
HDQFRPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacggatttttacaaactcgttccgggcgccccgaagggacgtttcgacggcatcgag
cgcacctacaccgccgccgacgtagcgcggctgcgcggctccgtcgaaatccgccattcg
ctggccgagatgggcgcgaaccggctgtggaagctcatcaacgaggagaatttcgtcaac
gcgctcggcgcgctttccggcaaccaagccatgcagatggttcgcgcaggattgaaggca
atttatctttccggctggcaggtcgccgcggacgccaacacggcatcggccatgtatccg
gaccagtcgctttatccggccaatgcggcaccggagctggccaagcgcatcaaccgcacc
ttgcagcgcgccgaccagatcgagacggcagagggcaagggtctttcggtcgacacctgg
tttgcgccgatcgttgccgatgcggaggccgggttcggcggcccactcaacgccttcgag
atcatgaaggcctttatcgaagcgggtgcggcgggtgttcactatgaagaccagctggca
tcggaaaagaagtgcggccatctcggcggcaaggttctgatcccgacggcggcgcatatt
cgcaacctgacggcagcgcggcttgctgctgatgtcatgggtgttccaacgctggttatc
gcccgcaccgatgcggaggccgccaagctgctgacatccgatatcgacgagcgcgaccag
ccctttgtggattacgatgccggccgcaccgtcgaaggtttctatcaggtcaagaacggt
cttgaaccctgcatcgcccgcgcggtggcctatgcaccctattgcgacctgatctggtgc
gaaacgtcaaagccggatctcgaacaggcacgcaggtttgcggaaggcgtgcacaaggtg
catcccggcaagaagctggcttacaattgctcgccgtcgttcaactggaaaaagaacctc
gacgacgcgacgattgccaagttccagcgtgaactgggcgcgatgggttacaagttccag
ttcatcacgcttgccggtttccaccagctgaatttcggcatgttcgaactggcgcgcggt
tacaaggaccggcagatggcggcctattccgagcttcaggaagcggaatttgcagccgag
gtcaacggttacaccgccaccaaacaccagcgcgaagtcggcaccggctatttcgacgcc
gtgtcgctcgccatttccggcggcacgtcctcgaccaccgcgatgaaggaatccaccgag
cacgaccagttccgcccggcggcggaataa

DBGET integrated database retrieval system