KEGG   Agrobacterium fabrum: Atu0767Help
Entry
Atu0767           CDS       T00070                                 

Gene name
coxB
Definition
cytochrome c oxidase subunit II
Orthology
K02275  
cytochrome c oxidase subunit II [EC:1.9.3.1]
Organism
atu  Agrobacterium fabrum
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Atu0767 (coxB)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Atu0767 (coxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762636..763499
Genome map
AA seq 287 aa AA seqDB search
MTCLLTAVGAHADQPVHWQMGMQEAATPIMHEIRWFEQYTLWFIVPVTLFVLALLIIVAV
KFHAAKNPVASKTSHNTAIEVVWTLAPVLILLFLAFPSFNLLNAQLTQPENPDLTLKATA
TQWLWSYEYKAAEGAEPLSFDSYLLKDQDRAAAGKEDKARYPRLLAVDNEMVVPVGKTVR
LLVTAAPTDVIHAFAMPAFGVKIDAVPGRLNETWFKPEKEGLYYGQCSELCGKDHAFMPI
AIRVVSEQQYNTWHAAAASDLNGANRALMASVDGAPRTVDVAANETN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacctgtctgctcacggctgtcggcgcccacgccgatcagccggtgcattggcaaatg
ggcatgcaggaggccgccacgccgatcatgcacgaaatacgctggttcgaacaatataca
ctgtggttcattgttccggtcacgcttttcgttcttgcgctgctcatcatcgttgccgtc
aagttccacgccgcgaaaaatccggtggcttccaagaccagccataacacggcgatcgag
gtggtgtggacgctggcgccggtgctcattctcctgttcctcgctttcccctcgttcaat
cttctgaacgcgcagctgacgcagccggaaaacccggacctgacgctgaaggcgaccgcc
acgcagtggctgtggagctatgaatacaaggccgccgagggcgcagagccgctctccttc
gacagctacctgctgaaggatcaggatcgcgccgctgccggcaaggaagacaaggcccgc
tatccgcgccttctcgcggtcgacaatgaaatggttgttcccgtcggcaagacagttcgc
cttctggtgacggcggctccgacggatgtcatccacgccttcgccatgcccgccttcggc
gtcaagatcgatgccgttccgggccgcctcaatgaaacatggttcaagccggagaaggaa
ggcctgtattacggccaatgttccgagctttgcggcaaggaccacgctttcatgccgatc
gccattcgggtggtttccgaacagcagtacaacacctggcacgccgccgccgcttcagat
ctgaacggcgcgaaccgggcgttgatggcctccgtcgatggcgctccgcgcacggtcgac
gttgccgccaacgaaaccaactga

DBGET integrated database retrieval system