KEGG   Agrobacterium tumefaciens C58: Atu0767Help
Entry
Atu0767           CDS       T00070                                 

Gene name
coxB
Definition
cytochrome c oxidase subunit II
Orthology
K02275  
cytochrome c oxidase subunit II [EC:1.9.3.1]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:atu00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762636..763499
Genome map
AA seq 287 aa AA seqDB search
MTCLLTAVGAHADQPVHWQMGMQEAATPIMHEIRWFEQYTLWFIVPVTLFVLALLIIVAV
KFHAAKNPVASKTSHNTAIEVVWTLAPVLILLFLAFPSFNLLNAQLTQPENPDLTLKATA
TQWLWSYEYKAAEGAEPLSFDSYLLKDQDRAAAGKEDKARYPRLLAVDNEMVVPVGKTVR
LLVTAAPTDVIHAFAMPAFGVKIDAVPGRLNETWFKPEKEGLYYGQCSELCGKDHAFMPI
AIRVVSEQQYNTWHAAAASDLNGANRALMASVDGAPRTVDVAANETN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacctgtctgctcacggctgtcggcgcccacgccgatcagccggtgcattggcaaatg
ggcatgcaggaggccgccacgccgatcatgcacgaaatacgctggttcgaacaatataca
ctgtggttcattgttccggtcacgcttttcgttcttgcgctgctcatcatcgttgccgtc
aagttccacgccgcgaaaaatccggtggcttccaagaccagccataacacggcgatcgag
gtggtgtggacgctggcgccggtgctcattctcctgttcctcgctttcccctcgttcaat
cttctgaacgcgcagctgacgcagccggaaaacccggacctgacgctgaaggcgaccgcc
acgcagtggctgtggagctatgaatacaaggccgccgagggcgcagagccgctctccttc
gacagctacctgctgaaggatcaggatcgcgccgctgccggcaaggaagacaaggcccgc
tatccgcgccttctcgcggtcgacaatgaaatggttgttcccgtcggcaagacagttcgc
cttctggtgacggcggctccgacggatgtcatccacgccttcgccatgcccgccttcggc
gtcaagatcgatgccgttccgggccgcctcaatgaaacatggttcaagccggagaaggaa
ggcctgtattacggccaatgttccgagctttgcggcaaggaccacgctttcatgccgatc
gccattcgggtggtttccgaacagcagtacaacacctggcacgccgccgccgcttcagat
ctgaacggcgcgaaccgggcgttgatggcctccgtcgatggcgctccgcgcacggtcgac
gttgccgccaacgaaaccaactga

DBGET integrated database retrieval system