KEGG   Agrobacterium fabrum: Atu0787Help
Entry
Atu0787           CDS       T00070                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
atu  Agrobacterium fabrum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Atu0787 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Atu0787 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Atu0787 (thrC)
Enzymes [BR:atu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Atu0787 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(784519..786090)
Genome map
AA seq 523 aa AA seqDB search
MAMVYSSDAGKNRLACSVLLEFSKKPFITSPIASFRRDAADKEPVTARTDRLRTRDYLVK
YVSTRGAAPSLGFCDALLAGLGRDGGLYVPREWPSMSKKEIRNLRGKSYQDVAFEVLYRF
TGGEIPADKFKAMIDDAYSTFRHPAVVPLTQTGPNTFVLELFHGTTLAFKDVAMQLLARL
MDYTLTERGERAAIVGATSGDTGGAAIDAFAGRERTDIFILFPNGKVSPVQQRQMTTSTA
SNVYALAINGNFDDCQTLVKEMFNDVKFRDGVKLSGVNSINWARIMAQVVYYFTASLSLG
GPDRKISFTVPTGNFGDIFAGYVAKKMGLPIDKLVIATNDNDILARTLKTGRYEMRGVKP
TTSPSMDIQISSNFERLLFEAYDRDSAAVKASMDGLKQSGAFEIPPKALKFIKKDFRAGR
ATEKQVAATIRDTLEKTGYLIDPHTATGVFVAEKHEKAGSPMVVLSTAHPAKFPAAVKSA
CAIEPALPVWLADIMNREERFDILDAELKAVETFIGQHARAGK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
ttggcgatggtctatagcagcgacgccggaaaaaatcgattggcatgttcggttttgctt
gaattttcaaaaaagcccttcattacctcgccaatcgcctcattccggcgggatgctgct
gataaagagccggtaacggcacggacagaccggttaaggacaagggactatctcgtgaaa
tatgtatcgaccaggggtgcggccccttcgcttggtttctgcgacgcgctgctggcaggc
cttggccgtgacggcgggctttacgtgccgcgcgagtggccttccatgtcgaagaaggaa
atccgcaacctgcgcggaaaatcctatcaggacgtcgccttcgaggttctctaccgtttc
accggcggcgaaattccggccgacaagttcaaggcgatgatcgacgacgcctattcgacg
ttccgtcaccctgccgtcgtgccactgacgcagaccggcccgaacaccttcgtgctggag
cttttccatggcaccacgctcgccttcaaggatgtggcgatgcagcttctcgcccgcctg
atggactatacgctgacggaacgcggcgagcgcgccgccattgtcggcgccacatcgggc
gacaccggcggtgcggcgatcgatgcctttgccgggcgcgaacgcaccgatatcttcatc
cttttcccgaacggcaaggtctcgccggtgcagcagcgccagatgacgacatccaccgct
tccaacgtgtatgcgctggcgatcaacggcaatttcgacgattgccagacgctggtcaaa
gagatgttcaacgacgtgaagttccgcgacggcgtgaagctttccggcgtcaactccatc
aactgggcgcgcatcatggcgcaggtggtgtattatttcaccgcctcgctgtcgctcggc
ggcccggaccggaagatttccttcaccgttccgacaggcaatttcggcgatatcttcgcc
ggttacgtcgccaagaagatggggctgccgatcgacaagctggtcatcgccaccaatgac
aacgacattctggcacgcacgctgaagaccggccgttacgagatgcgcggcgtcaagccc
accacctcgccttcgatggatatccagatttcgtccaacttcgaacgcctgctgtttgaa
gcctatgatcgcgattccgctgcggtgaaggcgtccatggatggcctgaagcagtccggc
gcgtttgaaattccgccgaaggcactgaaattcatcaaaaaggatttccgtgccggccgc
gccaccgaaaagcaggttgcggcgaccattcgcgacacacttgaaaagaccggatacctg
atcgacccgcatacggcgaccggcgttttcgtggctgagaagcacgaaaaagcgggaagc
ccgatggtggttctgtcgaccgcccacccggctaaattcccggccgctgtaaaatccgct
tgcgcaatcgagcctgcgcttccagtatggctagctgacattatgaaccgggaggagcgt
ttcgacattctggacgcagagctgaaagccgtggaaaccttcatcggccaacatgcacgc
gccggcaaatag

DBGET integrated database retrieval system