KEGG   Agrobacterium fabrum: Atu1111Help
Entry
Atu1111           CDS       T00070                                 

Gene name
holC
Definition
(RefSeq) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
atu  Agrobacterium fabrum
Pathway
atu00230  Purine metabolism
atu00240  Pyrimidine metabolism
atu01100  Metabolic pathways
atu03030  DNA replication
atu03430  Mismatch repair
atu03440  Homologous recombination
Module
atu_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Atu1111 (holC)
   00240 Pyrimidine metabolism
    Atu1111 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Atu1111 (holC)
   03430 Mismatch repair
    Atu1111 (holC)
   03440 Homologous recombination
    Atu1111 (holC)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Atu1111 (holC)
DNA replication proteins [BR:atu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Atu1111 (holC)
DNA repair and recombination proteins [BR:atu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Atu1111 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-GeneID: 1133149
NCBI-ProteinID: NP_354131
UniProt: Q7CZY9
Position
circular:1101373..1101822
Genome map
AA seq 149 aa AA seqDB search
MTEILFYHLTESKLEDALPPLLEKSLERGWKVAIQTVDDERRDFLDTHLWTFRDDSFLPH
ATDASSAPQNQPILLTASSENGNAANVRFLVDGAEPLAVETYERVVFMFDGYDAYQLEMA
RNHWKTLKAEGHSLTYWQQSPEGRWQKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattctgttctaccatctgacggaatcgaagctggaggatgcgctgccgcct
ttgctcgagaaatcgctggaacgcggctggaaggtcgcgatccagactgtcgacgatgag
cgtcgtgatttcctcgacacgcatctgtggacctttcgtgacgatagtttcctgccgcac
gccaccgatgcgtcgtcagcgccgcagaaccagccgattcttctgacggcgtcgagcgag
aacggcaatgcggcgaacgtacgctttctggtcgacggcgccgagccgctagcggtggag
acctatgagcgcgtcgtcttcatgttcgacggatacgacgcctaccagctggaaatggcg
cgtaaccactggaaaacgctgaaggcagaggggcattcgctgacctattggcagcaatct
cccgaaggtcgctggcaaaaaaaggcctga

DBGET integrated database retrieval system