KEGG   Agrobacterium fabrum: Atu1111Help
Entry
Atu1111           CDS       T00070                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
atu  Agrobacterium fabrum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Atu1111 (holC)
   00240 Pyrimidine metabolism
    Atu1111 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Atu1111 (holC)
   03430 Mismatch repair
    Atu1111 (holC)
   03440 Homologous recombination
    Atu1111 (holC)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Atu1111 (holC)
DNA replication proteins [BR:atu03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Atu1111 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101373..1101822
Genome map
AA seq 149 aa AA seqDB search
MTEILFYHLTESKLEDALPPLLEKSLERGWKVAIQTVDDERRDFLDTHLWTFRDDSFLPH
ATDASSAPQNQPILLTASSENGNAANVRFLVDGAEPLAVETYERVVFMFDGYDAYQLEMA
RNHWKTLKAEGHSLTYWQQSPEGRWQKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattctgttctaccatctgacggaatcgaagctggaggatgcgctgccgcct
ttgctcgagaaatcgctggaacgcggctggaaggtcgcgatccagactgtcgacgatgag
cgtcgtgatttcctcgacacgcatctgtggacctttcgtgacgatagtttcctgccgcac
gccaccgatgcgtcgtcagcgccgcagaaccagccgattcttctgacggcgtcgagcgag
aacggcaatgcggcgaacgtacgctttctggtcgacggcgccgagccgctagcggtggag
acctatgagcgcgtcgtcttcatgttcgacggatacgacgcctaccagctggaaatggcg
cgtaaccactggaaaacgctgaaggcagaggggcattcgctgacctattggcagcaatct
cccgaaggtcgctggcaaaaaaaggcctga

DBGET integrated database retrieval system