KEGG   Agrobacterium fabrum: Atu1245Help
Entry
Atu1245           CDS       T00070                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
atu  Agrobacterium fabrum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Atu1245 (speB)
Enzymes [BR:atu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Atu1245 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1234949..1235902)
Genome map
AA seq 317 aa AA seqDB search
MPAKTIDHAFTATTLTSAATDPTHAGVLSFMRRKYTKNLKGVSTAIWGIPFDAATSNRPG
ARFGPQAIRRASAIFDNDPQYPFARDLFAHMPTIDYGDCLLDYGNHWKTPDTIEKEARRI
ISKTDYLLTLGGDHFITWPLLKAHVAKHGRLALVQFDAHQDTWFDDGKRIDHGSFVARAV
RDGLIDPDRSIQIGIRTHAPDDFGIRILHGYEVEDMRASDIASLIVKHTGGMPAYLTFDI
DCLDPAFAPGTGTPVAGGPTSAKILSVLRGLGQLDIRGSDVVEVAPAYDHADITAIAGAT
VAMYMLGLRAERLAKAG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaaaacaatcgaccatgcctttaccgcgacaacgctgacttcggccgcaacc
gacccaacccatgcgggcgtcctctccttcatgcgacgcaagtatacaaagaacctcaag
ggcgtttcgacggcgatctggggtattccgtttgacgcggcaacctccaaccggccgggt
gcgcgcttcgggccgcaggcgatccgccgcgcgtccgcgatcttcgacaatgatccgcaa
tatcccttcgcgcgcgatcttttcgcccatatgccgaccatcgattatggcgactgcctg
ctcgactacggcaaccattggaaaacgcctgacacgatcgaaaaggaagcgcgcaggatc
atctccaagacggattatctgctgacgctcggcggtgatcacttcatcacctggccattg
ctgaaagcgcatgtggccaagcacgggcgtctggcgctagtgcagttcgacgcgcatcag
gatacatggttcgatgatggcaagcgcatcgaccacggctccttcgtggcgcgcgccgtg
cgcgacggactgatagatcctgaccgttcgatccagatcggtattcgcacccatgcgccc
gacgatttcggcatccgtattctccacggttacgaggtggaggatatgcgggcgagcgat
attgcctcgctgatcgtcaagcacacgggcggcatgcctgcttacctgaccttcgatatc
gattgcctcgatcccgctttcgcaccgggaaccggcacacccgtcgccggcggaccgacc
agcgccaagattctctcggttctgcgcgggctcggccagcttgatattcgcggctctgac
gtggtggaggtggcacccgcttacgatcatgcggatattaccgccattgccggggccacc
gttgcaatgtatatgcttggcctgcgtgccgaacggctggcgaaggctggctga

DBGET integrated database retrieval system