KEGG   Agrobacterium tumefaciens C58: Atu1256Help
Entry
Atu1256           CDS       T00070                                 

Definition
cytochrome P450 hydroxylase
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:atu00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:atu00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:atu00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1243230..1244477)
Genome map
AA seq 415 aa AA seqDB search
MTATFPFLKIDPATRRVSLNARDPAFYNDPNPVYAALHAQCPTFYWEEQRQWFFTCYDHV
STLLRDRRFGRQILHVASREEIGLPEPLEHVKHFDLAEQHSLLELEPPEHTRLRTLINRA
FVSRHVDKMKPEIEELANRLIEAFEANGETELLSSYADIIPVTMIARMIGIPEEMGPQLL
KWSHAYVGMYMFKRTPEDELLADKAAQEFSDYVRRVIAERRAEPKDDLLSHMIHTEHKGQ
YLTDDELVSTTIVLLNAGHEATVHQIGNSVRIILESGLDPKTLFHDETATERTVEETLRI
CAPVHIFQRWVLEPVEIDGVQFKRGDKVSLILAAANLDPAKFSDPLAFQPDRNEGANVSF
GAGIHFCIGAPLARLELNLALPLLFKRLPGLKIAEPPKVKDVYHFHGLERLDLAW
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgacatttccctttctcaaaatcgaccccgccacccgccgcgtttcccttaac
gcccgcgatccggccttctacaacgatccgaacccggtttacgccgccctgcacgcacaa
tgtcccaccttttactgggaagagcagcggcaatggtttttcacctgctatgaccatgtc
agcaccctgctgcgcgatcgccggttcgggcggcagatattgcatgtcgcaagtcgtgaa
gagatcggcttgccggagccgcttgagcatgtgaagcatttcgacctggccgagcagcat
tcgctcctggagctggagccgccggagcacacgcggctgcgcacgctgatcaaccgcgcg
ttcgtttcgcggcatgtcgataagatgaagccggaaatcgaggaactcgccaaccgcctg
atcgaggcctttgaagcgaatggcgagacggagctgctctcctcctatgccgacatcatt
ccggtgacgatgatcgcccgcatgatcggcattcccgaagagatggggccacagcttttg
aagtggtcgcatgcctatgtcggcatgtacatgttcaagcgcacgcctgaagacgagctt
ctggccgacaaggccgcgcaggaattttcagactatgtgcgcagagtcatcgccgagcgg
cgggcggagcccaaggacgatctgctgagccacatgatccatacggagcacaagggccag
tacctcaccgacgacgagctggtctccactaccatcgtgttattgaatgccggtcatgag
gcgacggtgcaccagatcggtaattccgtgcgcatcattctggaaagcggcctcgacccc
aagaccctgttccatgacgagaccgccacggaacgcacggtcgaggaaacgcttcgcatc
tgcgcgccggtccacatcttccagcgctgggttctcgaaccggtcgagatcgacggcgtg
cagttcaagcgtggcgataaagtcagtctcatcctggccgctgccaacctcgatccggcg
aaattttccgatcctctggccttccagccggatcggaacgagggcgccaacgtctccttc
ggcgccggcatccatttctgcatcggcgcgccgcttgcaagactggagcttaatctcgcc
ctgcccctgcttttcaaacgtctgccgggcctgaagattgccgagccgcccaaggtgaag
gacgtctatcatttccatggtctggagcggctcgatctggcgtggtag

DBGET integrated database retrieval system