KEGG   Agrobacterium fabrum: Atu1256Help
Entry
Atu1256           CDS       T00070                                 

Definition
cytochrome P450 hydroxylase
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
atu  Agrobacterium fabrum
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Atu1256
  Amino acid metabolism
   00380 Tryptophan metabolism
    Atu1256
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Atu1256
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Atu1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1243230..1244477)
Genome map
AA seq 415 aa AA seqDB search
MTATFPFLKIDPATRRVSLNARDPAFYNDPNPVYAALHAQCPTFYWEEQRQWFFTCYDHV
STLLRDRRFGRQILHVASREEIGLPEPLEHVKHFDLAEQHSLLELEPPEHTRLRTLINRA
FVSRHVDKMKPEIEELANRLIEAFEANGETELLSSYADIIPVTMIARMIGIPEEMGPQLL
KWSHAYVGMYMFKRTPEDELLADKAAQEFSDYVRRVIAERRAEPKDDLLSHMIHTEHKGQ
YLTDDELVSTTIVLLNAGHEATVHQIGNSVRIILESGLDPKTLFHDETATERTVEETLRI
CAPVHIFQRWVLEPVEIDGVQFKRGDKVSLILAAANLDPAKFSDPLAFQPDRNEGANVSF
GAGIHFCIGAPLARLELNLALPLLFKRLPGLKIAEPPKVKDVYHFHGLERLDLAW
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgacatttccctttctcaaaatcgaccccgccacccgccgcgtttcccttaac
gcccgcgatccggccttctacaacgatccgaacccggtttacgccgccctgcacgcacaa
tgtcccaccttttactgggaagagcagcggcaatggtttttcacctgctatgaccatgtc
agcaccctgctgcgcgatcgccggttcgggcggcagatattgcatgtcgcaagtcgtgaa
gagatcggcttgccggagccgcttgagcatgtgaagcatttcgacctggccgagcagcat
tcgctcctggagctggagccgccggagcacacgcggctgcgcacgctgatcaaccgcgcg
ttcgtttcgcggcatgtcgataagatgaagccggaaatcgaggaactcgccaaccgcctg
atcgaggcctttgaagcgaatggcgagacggagctgctctcctcctatgccgacatcatt
ccggtgacgatgatcgcccgcatgatcggcattcccgaagagatggggccacagcttttg
aagtggtcgcatgcctatgtcggcatgtacatgttcaagcgcacgcctgaagacgagctt
ctggccgacaaggccgcgcaggaattttcagactatgtgcgcagagtcatcgccgagcgg
cgggcggagcccaaggacgatctgctgagccacatgatccatacggagcacaagggccag
tacctcaccgacgacgagctggtctccactaccatcgtgttattgaatgccggtcatgag
gcgacggtgcaccagatcggtaattccgtgcgcatcattctggaaagcggcctcgacccc
aagaccctgttccatgacgagaccgccacggaacgcacggtcgaggaaacgcttcgcatc
tgcgcgccggtccacatcttccagcgctgggttctcgaaccggtcgagatcgacggcgtg
cagttcaagcgtggcgataaagtcagtctcatcctggccgctgccaacctcgatccggcg
aaattttccgatcctctggccttccagccggatcggaacgagggcgccaacgtctccttc
ggcgccggcatccatttctgcatcggcgcgccgcttgcaagactggagcttaatctcgcc
ctgcccctgcttttcaaacgtctgccgggcctgaagattgccgagccgcccaaggtgaag
gacgtctatcatttccatggtctggagcggctcgatctggcgtggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system