KEGG   Agrobacterium tumefaciens C58: Atu1354Help
Entry
Atu1354           CDS       T00070                                 

Gene name
folK
Definition
6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:atu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347990..1348490
Genome map
AA seq 166 aa AA seqDB search
MGLGGNIGDPAAAMARALRELDAHDDCRVQAVSGLYRTPPWGKTDQADFFNCCALVETSL
TALALLQLCLDIERGMKRVRTERWGPRTIDIDVLTYGNEAIVTESIEVPHPRMTERAFVL
MPLADIAPDLEVKGKPVRQWLQQADRSGIVRANEKREWWTLPLGDD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ctgggtctcggcggcaatatcggcgatcccgccgctgccatggcgcgggcgctgcgtgaa
ctcgacgcgcatgatgattgccgggtgcaggccgtttccggcctctatcgcacgccgccc
tggggaaagaccgatcaggcggatttcttcaattgctgtgcgctggtcgagacatcgctg
accgcgctggcgctgctgcaactctgcctcgatatcgaaaggggcatgaagcgggtgcgg
acggaacgctggggaccgcgcaccatcgatatagacgtgctgacttatggcaatgaggct
atcgttacggaaagcatcgaggtgccgcatccgcgtatgacggagcgcgcttttgtgctg
atgccgcttgccgacatcgcgcccgatcttgaggtcaagggaaagccggtgcggcaatgg
ctccagcaggcggacaggagtggcattgtccgcgcaaacgaaaagcgggagtggtggaca
ctcccgctcggcgatgactga

DBGET integrated database retrieval system