KEGG   Agrobacterium fabrum: Atu1595Help
Entry
Atu1595           CDS       T00070                                 

Definition
NADPH:quinone reductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
atu  Agrobacterium fabrum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Atu1595
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu1595
  Lipid metabolism
   00071 Fatty acid degradation
    Atu1595
  Amino acid metabolism
   00350 Tyrosine metabolism
    Atu1595
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Atu1595
   00626 Naphthalene degradation
    Atu1595
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Atu1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1577138..1578166)
Genome map
AA seq 342 aa AA seqDB search
MRALQLVDDRKLEKVDLPEPDAPGPGEVTLRVKAVALNHIDVWGWRGMAFAKRKMPLTIG
AEASGVVEAIGPGVSNVLPGQLVSVYGARTCGLCKPCREGRDNLCEHVQGVHGFHLDGFA
QEKINIPARQLVPAPHGIDAVAAALAPVTFGTVEHMLFDNAKLEPGETILIHAGGSGIGT
AAIQLAKKMGCTVITTVGSDDKIERAKALGADHVINYRTDRFEGVVRKLTKKKGVDVVFE
HVGKDTFVASMFSLKRGGRLVTCGSTSGVSTEINLMMLFQQQLKLLGSFGCRMENMANAM
QKMARGIVHPVIDTEVTFDDIDRALERMETRQVFGKIVLRMD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctcttcaactcgtggacgaccggaagctcgaaaaagtggacctgcctgaaccc
gatgctccgggtccgggcgaggtgacgctgcgcgtcaaggccgtggcgctcaaccacatc
gacgtttggggctggcgcggcatggctttcgccaagcgcaagatgccgctcaccatcgga
gcggaagcctccggcgtggtcgaggccattggccccggcgtttcgaatgtgctgccgggc
cagctcgtttcggtctatggcgcgcgcacctgcgggctctgcaagccctgccgtgaaggc
cgtgacaatctgtgcgaacatgtccagggcgtacacggtttccatctcgacggtttcgcg
caggaaaagatcaatattcccgcccgccagctcgtgccggccccgcacggcattgacgcc
gttgctgcggcgctcgccccggtgactttcggcaccgtcgagcacatgctgttcgacaat
gccaagcttgagcccggcgaaaccatcctcatccatgccggcggttccggcatcggcacg
gcggcgatccagcttgccaagaagatgggctgcaccgtcatcaccacggtcggttccgac
gacaagatcgaacgggcgaaggcgctcggggccgatcatgtcatcaattaccggaccgat
cgtttcgaaggcgtcgtgcgcaagctgacgaaaaagaagggtgtcgacgttgtcttcgaa
catgtcggcaaggataccttcgtcgcctcgatgttctcgctgaagcgcggtggccgtctc
gtcacctgcggctccacctcgggcgtttccaccgaaatcaatctgatgatgctgttccag
cagcagttgaagctgctcggctccttcggctgccgcatggaaaacatggccaatgccatg
cagaagatggcgcgcggcatcgttcatcccgtcatcgacaccgaagtcaccttcgacgat
atcgaccgggcactggagcgcatggaaacgcgccaggtgttcggcaagatcgtcctgcgg
atggattga

DBGET integrated database retrieval system