KEGG   Agrobacterium fabrum: Atu1620Help
Entry
Atu1620           CDS       T00070                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
atu  Agrobacterium fabrum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Atu1620 (tpiA)
   01230 Biosynthesis of amino acids
    Atu1620 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu1620 (tpiA)
   00051 Fructose and mannose metabolism
    Atu1620 (tpiA)
   00562 Inositol phosphate metabolism
    Atu1620 (tpiA)
Enzymes [BR:atu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Atu1620 (tpiA)
Exosome [BR:atu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Atu1620 (tpiA)
  Exosomal proteins of bladder cancer cells
   Atu1620 (tpiA)
  Exosomal proteins of melanoma cells
   Atu1620 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1604904..1605674)
Genome map
AA seq 256 aa AA seqDB search
MTPNVRPLVAGNWKMNGTRASLDQIKAMAEGVKGALSEKVDALICPPSTLLYVATALCDD
SPLLIGAQDCHQNDTGAHTGDISAEMIADCFGTHVIVGHSERRTDHAETDHLVRAKASAA
HQVDLIAIVCIGETADERKAGQTLDILKRQLAGSLPDEATAENTVIAYEPVWAIGTGLTP
TTQDVREAHAFMRDELVKRFGDAGKTMRILYGGSVKPANALELMGVENVDGALIGGASLK
AADFLSIYAAYEQLTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaatgttcgaccgcttgttgccggaaactggaagatgaacggcacccgtgcc
tcgctcgatcagatcaaggccatggcagagggcgttaagggcgcgctgtccgagaaggtg
gatgcgctgatctgcccgccctcgacattgctctacgtagcaacggcgctctgcgatgac
agcccgctgctgatcggcgcgcaggattgccaccagaatgataccggcgcccataccggc
gatatttccgccgagatgattgccgattgcttcggcacccatgttatcgttggccattcc
gagcgccgcaccgaccacgccgagaccgatcacctggttcgcgccaaggcatccgctgcc
catcaggtcgaccttatcgccatcgtctgcatcggcgagactgcggatgagcgcaaggcg
ggacagacgctggatattctcaagcgccagttggccggctccctgccggatgaagcgact
gctgaaaacaccgtcatcgcctatgagcctgtgtgggcgattggcaccggtcttaccccg
accacgcaggacgtgcgcgaagcccatgccttcatgcgcgacgagctggtcaagcgcttc
ggtgacgccggcaagaccatgcgcattctctatggtggttcggtgaagcccgccaatgcg
ctggaactgatgggcgtcgagaatgtcgatggcgcgctgatcggcggcgccagcttgaaa
gccgcagacttcctttccatctatgcggcatatgagcaactgacggcctga

DBGET integrated database retrieval system