KEGG   Agrobacterium fabrum: Atu1688Help
Entry
Atu1688           CDS       T00070                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
atu  Agrobacterium fabrum
Pathway
atu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01130  Biosynthesis of antibiotics
atu01230  Biosynthesis of amino acids
Module
atu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Atu1688 (trpC)
Enzymes [BR:atu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Atu1688 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 1133726
NCBI-ProteinID: NP_354674
UniProt: Q7CYR2
Position
circular:1672673..1673488
Genome map
AA seq 271 aa AA seqDB search
MSDILKKIETYKLEEIAAAKAKVSLADLKAMAADQSAPRGFYKALRAKQAAGKFGLIAEI
KKASPSKGLIRPDFDPPALAAAYEAGGAACLSVLTDTPSFQGAPEFLTAARNACALPALR
KDFMFDTYQVHEARAWGADCILLIMASLSDDEAKRLEDEAFALGMDVLIEVHDAEETERA
LKLTSPLLGINNRNLRTFEVGLETSEKLAGLVPADKLLVGESGIFTFEDCQRLEKSGIST
FLVGESLMRKDDVTAATKALLTGHSGILAAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcaaaaagatcgagacctacaagctggaggaaatcgccgccgccaag
gccaaggtttcgctggccgatctgaaggccatggccgcagaccagagcgcaccgcgcggt
ttctataaggcgctgcgcgcaaagcaggccgcaggcaagttcggcctcatcgccgaaatc
aagaaggccagcccctccaagggcctcatccgcccggatttcgacccgccggcgctggcc
gctgcctatgaggcgggtggtgccgcctgcctctcggtcctgacggatacgccgagcttt
cagggcgcgccggaatttctgaccgccgcccgtaatgcctgcgctctgccggcactgcgc
aaggatttcatgttcgatacctatcaggtgcatgaggcccgcgcctggggtgcggattgc
atcctgctgatcatggcatcgctttccgacgacgaggcgaagcggctcgaggacgaggct
tttgcgcttggcatggacgtgctgatcgaagttcatgatgcggaggaaaccgaacgggcg
ctgaaactcacttccccgcttctcggtatcaacaaccgcaatctgcgcaccttcgaagtc
ggcctcgaaaccagcgagaagctcgcaggcctcgtgccggccgacaagctgctggtcggc
gaaagcggcatcttcaccttcgaggattgccagcgcctggaaaagagcggcatcagcaca
ttcctcgtcggcgaaagcctgatgcgcaaggacgatgtgacggcggcgaccaaggccctg
ctgaccggccactccggcattctggccgcggaataa

DBGET integrated database retrieval system