KEGG   Agrobacterium fabrum: Atu1691Help
Entry
Atu1691           CDS       T00070                                 

Definition
(RefSeq) GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
atu  Agrobacterium fabrum
Brite
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Atu1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1675687..1676757
Genome map
AA seq 356 aa AA seqDB search
MNTASTPKTTGPDIAGQIAYAMRSMGVSPIPRNYSLFYEAYIGSNPALTKDLAALGNRVT
QEDLDELSSRYGEGNPNRSIDDAQDKLRRELEALLGTLKREQSSIENYNRILGETRQRID
DKNAASNNILRNAISLLADATGSKIIDGEKTFNDVNRHAEEMHQVRLELDEYKRIANTDS
LTRLSNRRAFDDRLASVYDSSIGLQYTTLVLLDIDHFKRINDTFGHPVGDKILATVASVI
RANVRKDGFVARSGGEEFAIILDGNTPEEVMVMCERIRLSLESTPFRNSRSGADYGTVTI
SIGFASAARASNPSELYGHADTALYHAKETGRNRSVFYEDGMQNNYTGKNWLIYRT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggcatccacgcccaaaaccacggggcccgacattgccgggcagattgcctat
gccatgcggagcatgggtgtttcgccgatccctcgtaattatagtctgttttacgaagcc
tatatcggctcgaacccggcgctcacgaaagatctggcggcgcttggcaaccgggtcacg
caggaggatctggacgagttgtcgtcgcgttacggcgaaggcaatcccaaccgctccatc
gacgacgcgcaggacaaactgcggcgcgagctggaggcgctgctgggcacgctgaagcgc
gaacaatcctccatcgagaattacaaccgcattctcggcgaaacgcgccagcgcatcgat
gacaagaacgccgccagcaacaatattctgagaaatgcgatttcactgctggccgatgcc
accggctcgaaaatcatcgatggcgaaaagacgttcaacgacgtcaaccgccatgccgag
gaaatgcatcaggtgcgcctcgagctcgatgaatataagcgcatcgccaacaccgattcg
ctgacgcgcctctccaaccggcgcgctttcgacgaccggctggcctccgtttatgacagc
tccatcggcctgcaatataccacgctcgtccttctggatatcgatcacttcaagcgaatc
aacgatacgttcggccatccggtcggcgacaagattctcgccaccgtcgcctccgtcatc
cgcgccaatgtgcgcaaggatggtttcgttgcccgaagcggcggcgaggaattcgccatc
attctcgatggcaatacgccggaagaggtgatggtgatgtgcgaacgcatccgcctgtcg
ctggaaagcacgcccttccgcaattcgagatcaggtgccgattacggcacggtcaccatc
tcgataggcttcgcatcagccgcacgcgccagcaatcccagcgagctttacggccatgcc
gatacggcgctctaccacgccaaggaaaccggccggaaccgttccgtcttttacgaggac
ggcatgcagaacaattataccggcaagaactggctgatttatcggacgtga

DBGET integrated database retrieval system