KEGG   Agrobacterium fabrum: Atu1691Help
Entry
Atu1691           CDS       T00070                                 

Definition
GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
atu  Agrobacterium fabrum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1675687..1676757
Genome map
AA seq 356 aa AA seqDB search
MNTASTPKTTGPDIAGQIAYAMRSMGVSPIPRNYSLFYEAYIGSNPALTKDLAALGNRVT
QEDLDELSSRYGEGNPNRSIDDAQDKLRRELEALLGTLKREQSSIENYNRILGETRQRID
DKNAASNNILRNAISLLADATGSKIIDGEKTFNDVNRHAEEMHQVRLELDEYKRIANTDS
LTRLSNRRAFDDRLASVYDSSIGLQYTTLVLLDIDHFKRINDTFGHPVGDKILATVASVI
RANVRKDGFVARSGGEEFAIILDGNTPEEVMVMCERIRLSLESTPFRNSRSGADYGTVTI
SIGFASAARASNPSELYGHADTALYHAKETGRNRSVFYEDGMQNNYTGKNWLIYRT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggcatccacgcccaaaaccacggggcccgacattgccgggcagattgcctat
gccatgcggagcatgggtgtttcgccgatccctcgtaattatagtctgttttacgaagcc
tatatcggctcgaacccggcgctcacgaaagatctggcggcgcttggcaaccgggtcacg
caggaggatctggacgagttgtcgtcgcgttacggcgaaggcaatcccaaccgctccatc
gacgacgcgcaggacaaactgcggcgcgagctggaggcgctgctgggcacgctgaagcgc
gaacaatcctccatcgagaattacaaccgcattctcggcgaaacgcgccagcgcatcgat
gacaagaacgccgccagcaacaatattctgagaaatgcgatttcactgctggccgatgcc
accggctcgaaaatcatcgatggcgaaaagacgttcaacgacgtcaaccgccatgccgag
gaaatgcatcaggtgcgcctcgagctcgatgaatataagcgcatcgccaacaccgattcg
ctgacgcgcctctccaaccggcgcgctttcgacgaccggctggcctccgtttatgacagc
tccatcggcctgcaatataccacgctcgtccttctggatatcgatcacttcaagcgaatc
aacgatacgttcggccatccggtcggcgacaagattctcgccaccgtcgcctccgtcatc
cgcgccaatgtgcgcaaggatggtttcgttgcccgaagcggcggcgaggaattcgccatc
attctcgatggcaatacgccggaagaggtgatggtgatgtgcgaacgcatccgcctgtcg
ctggaaagcacgcccttccgcaattcgagatcaggtgccgattacggcacggtcaccatc
tcgataggcttcgcatcagccgcacgcgccagcaatcccagcgagctttacggccatgcc
gatacggcgctctaccacgccaaggaaaccggccggaaccgttccgtcttttacgaggac
ggcatgcagaacaattataccggcaagaactggctgatttatcggacgtga

DBGET integrated database retrieval system