KEGG   Agrobacterium tumefaciens C58: Atu1749Help
Entry
Atu1749           CDS       T00070                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:atu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1736303..1736929
Genome map
AA seq 208 aa AA seqDB search
MDAIVKNFPGAGAKPDVAEARPSQAEAEEAVRVLLRWAGENPAREGLLDTPKRVAKAYRE
LFAGYELNVQDVLGTTFEEVGGYDDVVLVRDIPFFSHCEHHMVPIVGKAHVAYLPAGRVL
GLSKIARVVEIFGRRLQTQENMTAQIARSIEETLKPRGVAVMIDAEHMCMSMRGVNKQGS
TTLTTSFTGTFKNDPAEQVRFMTMVRNR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgatcgtgaagaatttccccggcgctggcgcaaaaccagacgtggccgaagct
cgcccaagccaggccgaagcggaagaagccgtgcgcgttctcctgcgctgggcaggagaa
aatcccgcccgcgaaggacttctggatacgccgaagcgcgtcgccaaggcctatcgcgag
ctttttgccggttatgagctgaatgttcaggacgtgcttggcacgaccttcgaggaagtc
ggcggttatgacgatgtggtgctggtgcgcgacatccccttcttctcccattgcgagcac
catatggtgccgatcgtcggcaaggcgcatgtcgcctatcttccggccggccgtgtgctt
ggcctgtcgaagatcgcccgcgtcgtcgaaatcttcggccgccgcctgcagacgcaggaa
aacatgacggcgcagatcgcaagatcgatcgaagaaacgctgaaaccgcgtggcgtagcc
gtcatgatcgacgcggaacatatgtgcatgtccatgcgcggcgtaaacaagcaagggtcc
acgacgctgaccaccagcttcaccggcacgttcaagaacgatccggccgagcaggtgcgc
ttcatgaccatggtgcggaaccgctga

DBGET integrated database retrieval system