KEGG   Agrobacterium fabrum: Atu1859Help
Entry
Atu1859           CDS       T00070                                 

Gene name
glsA
Definition
(RefSeq) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
atu  Agrobacterium fabrum
Pathway
atu00220  Arginine biosynthesis
atu00250  Alanine, aspartate and glutamate metabolism
atu00471  D-Glutamine and D-glutamate metabolism
atu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Atu1859 (glsA)
   00220 Arginine biosynthesis
    Atu1859 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Atu1859 (glsA)
Enzymes [BR:atu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Atu1859 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase DUF5477
Motif
Other DBs
NCBI-GeneID: 1133897
NCBI-ProteinID: NP_354841
UniProt: Q8UEA1
Position
circular:complement(1838691..1839620)
Genome map
AA seq 309 aa AA seqDB search
MQDIQGIVDSIYDSMLPRLGEGKVADYIPELAKVDPNQFGIAITTVDGTTYTAGNALVPF
SIQSISKVFMLTLALGKAGETVWNRVGREPSGSSFNSIVQLEHEHGIPRNPFVNAGAIVV
TDIVLSGHQPREAIGELLRFVRYLADDDTISIDDTVAKSEQATGFRNFALANFMRSFGNL
HHPVEHTLGVYFHQCALSMTCAQLSRAGLFLANRGRNPLSGHTVVSDRRARRINALMLTC
GHYDGSGDFAYHVGLPGKSGVGGGIMAVAPGNASIAVWSPGLNKVGNSALGSQALELLAT
KTGWSVFGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacattcagggtatcgtcgattccatctacgacagcatgctgccgcggctgggt
gaggggaaggttgcggattacattcccgaactcgccaaggtcgatcccaaccagtttggc
atcgccatcaccaccgtcgatgggacgacctatacggccggcaatgcgcttgtgccgttt
tcgatccagagtatctccaaggttttcatgctgacgctggcgctcggcaaggcgggcgaa
acggtgtggaaccgggtggggcgcgaaccatcgggatcgtctttcaattccatcgttcag
ctggaacatgagcacggcatcccgcgcaatcccttcgtgaatgccggcgccatcgtggtg
accgatatcgttctttccggccatcagccgcgtgaggcgatcggcgagcttctgcggttc
gtgcgttacctcgctgacgatgacacgatcagcattgacgacacggtggcgaaatccgag
caggcgacgggtttccgcaatttcgcgcttgctaatttcatgcggtccttcggcaatctg
caccatcccgtggaacatacgctcggcgtttatttccatcagtgtgcactttccatgacc
tgcgcgcagctgtcgcgggctggcctcttccttgccaatcgcggccgtaatccgctctcc
ggccataccgtcgtgtcggaccgtcgggcgcggcgtattaatgcgctgatgctgacctgc
ggccattatgacggatccggcgatttcgcctatcatgtcggcctgccgggcaagagcggc
gtcggtggcggcatcatggcggtggcgccgggcaacgcgtcgattgcggtctggtcgccg
ggtctcaacaaggtcggcaattcggcgctcgggtcacaggcgctggaattgctggcgacc
aaaaccggctggtcggtattcggggcttga

DBGET integrated database retrieval system