KEGG   Agrobacterium fabrum: Atu2151Help
Entry
Atu2151           CDS       T00070                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
atu  Agrobacterium fabrum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Atu2151 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu2151 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Atu2151 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Atu2151 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Atu2151 (adh)
   00626 Naphthalene degradation
    Atu2151 (adh)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Atu2151 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2115801..2116844
Genome map
AA seq 347 aa AA seqDB search
MRALYYERFGETPVVASLPDPAPSDGGVVIAVKATGLCRSDWHGWMGHDTDIRLPHVPGH
EFAGVISAVGRNVTRFKTGDRVTVPFVSGCGHCHECRSGNQQVCETQFQPGFTHWGSFAE
YVAIDYADQNLVHLPESMSYATAAGLGCRFATSFRAVTDQGRLKGGEWLAVHGCGGVGLS
AIMIGAGLGAQVVAIDIAEDKLELARQLGATATINSRSVADVAEAVRDITGGGAHVSVDA
LGHPQTCCNSISNLRRRGRHVQVGLMLADHAMPAIPMARVIAHELEIYGSHGMQAWRYED
MLAMIESGRLAPEKLIGRHISLTEAAVALPGMDRFQESGISIIDRFE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctttattacgaacgattcggcgagacccctgtagtcgcgtccctgcctgat
ccggcaccgagcgatggcggcgtggtgattgcggtgaaggcaaccggcctctgccgcagc
gactggcatggctggatgggacatgacacggatatccgtctgccgcatgtgcccggccac
gagttcgccggcgtcatctccgcagtcggcagaaacgtcacccgcttcaagacgggtgat
cgcgttaccgtgcctttcgtctccggctgcggccattgccatgagtgccgctccggcaat
cagcaggtctgcgaaacgcagttccagcccggcttcacccattggggttccttcgccgaa
tatgtcgccatcgactatgccgatcagaacctcgtgcacctgccggaatcgatgagttac
gccaccgccgccggcctcggttgccgtttcgccacctccttccgggcggtgacggatcag
ggacgcctgaagggcggcgaatggctggctgtccatggctgcggcggtgtcggtctctcc
gccatcatgatcggcgccggcctcggcgcacaggtcgtcgccatcgatattgccgaagac
aagctcgaactcgcccggcaactgggtgcaaccgcaaccatcaacagccgctccgttgcc
gatgtcgccgaagcggtgcgcgacatcaccggtggcggcgcgcatgtgtcggtggatgcg
cttggccatccgcagacctgctgcaattccatcagcaacctgcgccggcgcggacgccat
gtgcaggtggggctgatgctggcagaccatgccatgccggccattcccatggcccgggtg
atcgctcatgagctggagatctatggcagccacggcatgcaggcatggcgttacgaggac
atgctggccatgatcgaaagcggcaggcttgcgccggaaaagctgattggccgccatatc
tcgctgaccgaagcggccgtcgccctgcccggaatggataggttccaggagagcggcatc
agcatcatcgaccggttcgaatag

DBGET integrated database retrieval system