KEGG   Agrobacterium fabrum: Atu2208Help
Entry
Atu2208           CDS       T00070                                 

Gene name
csaA
Definition
secretion chaperone
Orthology
K06878  
tRNA-binding protein
Organism
atu  Agrobacterium fabrum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2178576..2178917)
Genome map
AA seq 113 aa AA seqDB search
MSGEISYADFEKVDIRVGTIVEAVPFPEARKPAIKVKIDFGPEIGIKKSSAQITVHYTPE
SLVGRQVLGVVNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMC
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgaaatttcctatgccgatttcgaaaaggtcgatatccgcgtcggtacgatc
gtggaggcggtgccgtttccggaggctcgcaagcctgcgatcaaggtgaagatcgatttc
ggacccgagatcggcatcaaaaaatcctctgcgcagatcacggtgcattatacgccggaa
agcctggtcggccggcaggttctgggcgtggtgaattttccgccgcgccagatcggtcct
ttccggtccgaagttctgacgctcggttttgccgatgcaaacggcgatatcgtgttggcc
gcggttgaacgccctgtgccgaacggtgagaagatgtgctga

DBGET integrated database retrieval system