KEGG   Agrobacterium tumefaciens C58: Atu2371Help
Entry
Atu2371           CDS       T00070                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
atu  Agrobacterium tumefaciens C58
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2344447..2345514)
Genome map
AA seq 355 aa AA seqDB search
MRIGRRNFLGGAASAGLLHAVAGPAFAAQKKAAIKTAPYGAAIYLPDLTADSRIGEAVVK
YCSRITPVTEMKWEVMRPSAEVFDFAAADALANFARQHKLSMHGHPLIWYASNAPWLASV
GGAKVEKLMETHIVTVMERYKDVIHSWDVVNEPIPDVPGNVRARRDAWYYGAGPDAIKKA
FDIAHAVDPKAQLVLNEYDVEFAVEKSPAKRAAFRNLILELLEKGAPINAVGLQGHLRGG
WPIAKDELAAFTTEMRSYGLAVMVTELDVMDQTLPTPEAERDMLITGQVREFLEAASAGG
PLSSITTWGISDQYSWIRWAYPRRDGTANRPLPLDWSFNEKPMMAVINEFRNRGA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgggcggcggaattttctgggtggtgcggcaagcgctggcctgttgcatgcc
gtggccgggccggcctttgccgcgcagaagaaggctgcgatcaaaaccgccccctatggc
gccgccatctacctgccggatcttaccgccgacagccgtatcggcgaggcggtggtgaaa
tattgctcgcgcattacccccgtcaccgaaatgaaatgggaggtgatgcggccttcggca
gaggttttcgatttcgccgctgcagatgcactcgccaatttcgcgcgccagcacaagctt
tccatgcatggccatccgctgatctggtatgcctccaacgcgccgtggcttgccagtgtc
ggcggcgcgaaggtcgagaagctgatggaaacccatatcgtcaccgtgatggagcgatat
aaggatgtgatccacagctgggatgtcgtcaatgaaccgatccccgacgtgcctggcaat
gtgcgtgcacggcgcgatgcctggtattacggcgccgggcctgacgccatcaagaaggct
ttcgacatcgcccatgcggtcgatccgaaggcgcagctcgtgctcaacgaatatgacgtg
gaatttgctgtcgagaaatcgccagccaaacgtgcggccttccgcaatctcatcctcgag
ctgctcgaaaagggcgcgccgatcaacgccgtcggcctgcaggggcatttgcgtggcggc
tggccaatcgccaaggacgagctggcggccttcacgacggaaatgcgcagttacggtctt
gccgtcatggtgacggagcttgacgtgatggaccagacgctgcccacaccggaggccgag
cgtgatatgctgatcaccggccaggtccgcgagtttctcgaggccgcttctgcaggcggg
ccgctttcttccatcacgacatggggcatttcggatcaatacagctggatccgctgggcc
tatccacgccgggacggcaccgccaaccggccgctgccgctcgactggagtttcaacgaa
aaacccatgatggccgtcatcaatgaattccggaaccgtggtgcatga

DBGET integrated database retrieval system