KEGG   Agrobacterium tumefaciens C58: Atu2428Help
Entry
Atu2428           CDS       T00070                                 

Gene name
pssB
Definition
exopolysaccharide production protein PssB
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:atu00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2400483..2401325
Genome map
AA seq 280 aa AA seqDB search
MAKPRYGMPPLPDGCGKEMIDILTKAALDAGQAIMVVHRAGPHVSYKDDCSPVTEADQRA
ETIILEALAAHFPEIPVVAEEAVSNGILPETGAEFFLVDPLDGTKEFISGKDDFTVNIAL
IRNGVPVAGVVYAPCRGQAWTGKDNAAEKLAISGDGAILSRHPIRARRRGASPVALISRS
HCTAKTEAFVAEHGLKDCISVGSSLKFCMLAEGAADIYPRFSRTMMWDTAAGDAVLRAAG
GRTLDCDGQLLAYEVRGDGEDALANPDFIAEGAMAVEQAG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccccgttacgggatgcccccgttgccggatggctgtggcaaagagatgatc
gacatattgacgaaagcggcgcttgacgccggacaggcgatcatggtggttcaccgcgcc
ggcccgcatgtgtcctataaggacgactgctcgccggtaaccgaagccgatcagcgcgcc
gagacgattattctcgaggcgctggctgcccatttccctgaaattcccgtggttgccgaa
gaggccgtgtcgaacggcatcctgccggaaaccggggcggagttctttctggtcgatccg
cttgacggcacgaaggaattcatttccggcaaggacgatttcaccgtcaatatagcgctc
atccgcaatggcgtgccggtggcaggcgttgtctacgccccctgtcgcggccaggcatgg
acgggcaaggacaacgccgccgaaaagctcgcaatatcaggcgacggcgcgatcctgtcg
cgccaccccatccgggcccgccgacgcggcgcttcgcctgtggcgctgatcagccgctcg
cattgcacggcaaagacggaagccttcgtggccgaacacgggctgaaagactgtatctcg
gtcggttcatcactgaaattctgcatgctggcggagggtgccgccgatatctacccccgc
ttcagccgcaccatgatgtgggacaccgccgccggcgacgccgtactgcgtgccgcaggc
ggccggacactcgattgcgacgggcagcttcttgcctatgaagttaggggcgacggcgag
gatgcgctggccaatccggattttattgccgagggagcgatggcggtggagcaggccggg
taa

DBGET integrated database retrieval system