KEGG   Agrobacterium fabrum: Atu2635Help
Entry
Atu2635           CDS       T00070                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
atu  Agrobacterium fabrum
Pathway
atu00020  Citrate cycle (TCA cycle)
atu00310  Lysine degradation
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
atu01200  Carbon metabolism
Module
atu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
atu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Atu2635 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Atu2635 (sucB)
Enzymes [BR:atu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Atu2635 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Fim-adh_lectin RnfC_N
Motif
Other DBs
NCBI-GeneID: 1134673
NCBI-ProteinID: NP_355571
UniProt: A9CHK2
Position
circular:complement(2618190..2619422)
Genome map
AA seq 410 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDTVKADEPLVELETDKVTVEVPAPASGVLTEIV
AQNGETVGLDALLGQIAEGAAGAATSAPAAKPAAPAAAPAPAAAVAAAPGGSAMPPAPAA
GKLLAENNLSADQVDGSGKRGQVLKGDVLAAVAKGVSAPAAAPAPVAAPRPVSAEQDQVR
EERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMDLRNRYKDVFEKKHGVKLGFM
GFFTKAVTHALKELPAVNAEIDGTDIIYKNYCHVGMAVGTDKGLVVPVIRDADQLSIAGV
EKELGRLAKAARDGSLGMADMQGGTFTITNGGVYGSLMSSPILNAPQSGILGMHKIQERP
VAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaaatccgcgtaccaaccctcggcgaatccgtcagcgaagcgaccgtcggc
acctggttcaagaaggtcggcgataccgtcaaggccgacgaacctctcgttgaactcgaa
accgacaaggttaccgtcgaagtcccggcccctgcgtcaggcgttctcaccgaaatcgtt
gcgcagaacggcgagaccgttggtctcgacgcgcttctcggccagatcgccgaaggtgct
gccggcgctgcgacttctgcacctgcggcaaagcctgctgcgcccgccgccgcaccggca
cctgccgcagccgtagccgccgctccgggtggcagcgccatgccaccggcacctgccgct
ggcaagctgcttgccgaaaacaacctgtctgccgatcaggttgacggttcgggcaagcgt
ggtcaggttctgaagggcgacgttcttgccgctgtcgccaagggcgtttcggcacctgcc
gccgcaccggcaccggttgccgccccccgtccggtttcggccgagcaggatcaggttcgc
gaagagcgcgtcaagatgacccgtctgcgccagacgatcgcccgccgcctgaaggacgcg
cagaacaccgccgccatgctcaccacttacaacgaagtggacatgagcgcggtcatggac
cttcgtaaccgctacaaggacgtgtttgaaaagaagcacggcgtcaagcttggcttcatg
ggcttcttcaccaaagccgtgacccacgcgctgaaggagctgcctgctgtcaacgctgaa
atcgacggcacggacatcatctacaagaactattgtcacgtcggcatggctgtcggcacc
gacaagggcctcgtcgttcctgttatccgtgatgccgaccagctctccatcgccggcgtc
gaaaaggaactcggtcgccttgccaaggcagcccgtgacggttcgctcggcatggcggac
atgcagggcggcaccttcaccatcaccaatggtggcgtctacggttcactaatgtcttcg
ccgatcctcaacgcaccgcagtcgggcattctcggcatgcacaagatccaggagcgcccg
gtcgccatcggcggtcaggtcgtcatccgcccgatgatgtatcttgcgctctcctacgat
caccgtatcgttgacggcaaggaagccgtgaccttcctcgttcgcgtcaaggagagcctc
gaggatccggaacgtctggttctcgatctctga

DBGET integrated database retrieval system