KEGG   Agrobacterium fabrum: Atu2653Help
Entry
Atu2653           CDS       T00070                                 

Gene name
hem4
Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
atu  Agrobacterium fabrum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Atu2653 (hem4)
Enzymes [BR:atu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Atu2653 (hem4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2636615..2637355
Genome map
AA seq 246 aa AA seqDB search
MRIVVTRPQRSGERTAAKLEALGHAPVLLPLFHPIHHGERATSALSDPAGAIAVTSAEAL
RALATCEEQLAPYLSKPLFAVGGATAEAAQETGFEQIFTASGDALGLTVLVKQHRAFLTE
EEPLLYLAGRPRGSVFEEGLAAAGIPFRTVDCYEMLPSDISENTLETTLLDTTADMVLLY
SSEAARAFFHHVSADKYVTALAATKFICISRNVLFLVPEIFRANAKAAEEPSEAAMFELL
HHNSGT
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgcggatcgtcgtcacccggccgcagcgttcgggcgaaaggacggctgcaaagcttgaa
gcgcttggccatgcgccggtgcttctgccgctgtttcatcccatccatcatggcgaacgc
gccacctcggcgctgtccgatccggcgggcgctatcgcggtgaccagcgctgaagccttg
cgggcgctggcaacgtgcgaagaacagcttgccccctatctgtcgaaaccgcttttcgcc
gtcggcggggcaacggcggaagcagcgcaagaaaccggcttcgagcagatattcaccgcc
tccggagatgctctgggtctgaccgtgctggtgaaacagcaccgcgcttttttgactgaa
gaagaacccttgctctatctcgccggcaggccacgtggctccgtcttcgaagagggcctt
gccgccgcgggcattcccttcagaacggtcgactgttacgagatgctgccctcggatatc
tccgaaaacacgctcgaaacgacgcttctcgacacgaccgccgatatggtcctgctctat
tcctctgaagcggcgcgggcctttttccatcatgtatcggcggataaatacgtgacggcg
ctggcggcgacaaaattcatctgcatcagccgcaacgtgctgtttctggttccggaaatc
ttccgcgcaaatgccaaggccgccgaagagccgagcgaagccgcgatgttcgaacttctg
caccataactctggaacctaa

DBGET integrated database retrieval system