KEGG   Agrobacterium tumefaciens C58: Atu2719Help
Entry
Atu2719           CDS       T00070                                 

Definition
aldose epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:atu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:atu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2704613..2705632
Genome map
AA seq 339 aa AA seqDB search
MSDGAAREDFGFTATGEKVERVTISKDGLTAKVITWGAVIQDLRLDGHQAPLVLGFDKFE
DYKYSSYFGATPGRNANRIGNGRFAIDGHEYQLELNEKGVTHLHGGSDGMGKRNWMLMEH
GESHAVLQIIDPDGRAGYPGNCTVTATYTIRDGGVLSVVYETVTDQPTIANVCQHSYFNL
DGADTALGHEISIAADFYLPTNEQQIPTGEIRSVEGTVFDLRHPTPMRRKENGEQVLYDH
NFCLSPERRAKRKVARAYSPASDIALEVHTTEPGVQFYSAFKLDVPVPGLDGRHYGPFAG
FCLETQIWPDAVNHPDFPHAILRPGETLRQETDYIFRKG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacggtgcggcacgagaagattttggtttcacggcgaccggcgaaaaggtcgaa
cgcgtcaccatctcgaaagacggtttgacggcgaaagtcatcacctggggcgctgttatc
caggatctgcggcttgacggccaccaggccccgttggtgcttggcttcgacaaattcgag
gattacaaatactcctcctatttcggcgccacgcccggccgcaatgccaaccgtatcggc
aacggcaggttcgcgatcgacggccatgaataccagctagaactgaacgaaaagggcgtg
acccatctgcacggcggcagcgacggcatgggcaagcgcaactggatgctgatggagcat
ggcgaaagccacgccgtcctgcagattatcgaccccgatggacgcgccggttatcccggc
aattgcacggtcactgctacctatacgatccgcgatggcggcgtgctttcggttgtttat
gaaacggtgaccgaccagccgaccatcgccaatgtgtgccagcactcctatttcaacctc
gacggcgcggataccgcacttggccatgagatcagcatcgccgctgacttttacctgccg
accaacgaacagcagataccgaccggcgaaatccgctccgtcgaaggcaccgtcttcgac
ctgcgccacccgacgccgatgcggcgcaaggagaatggcgaacaggttctctacgaccac
aatttctgcctttcgcccgagcgtcgcgccaagcgcaaggtcgcccgcgcctattcacct
gcctccgatatcgcccttgaagtccacacgacagagcccggtgtgcagttctattcagcc
ttcaagctcgacgttcccgttccgggcctcgatggccgccattatggccccttcgccggt
ttctgccttgaaacgcagatttggcccgatgccgtcaatcacccggattttccgcacgcc
atcctgcggccgggcgaaacgctgcgtcaggaaacggattatattttcaggaagggctga

DBGET integrated database retrieval system