KEGG   Agrobacterium fabrum: Atu2745Help
Entry
Atu2745           CDS       T00070                                 

Gene name
acs
Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
atu  Agrobacterium fabrum
Pathway
atu00010  Glycolysis / Gluconeogenesis
atu00620  Pyruvate metabolism
atu00640  Propanoate metabolism
atu00680  Methane metabolism
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
atu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu2745 (acs)
   00620 Pyruvate metabolism
    Atu2745 (acs)
   00640 Propanoate metabolism
    Atu2745 (acs)
  Energy metabolism
   00680 Methane metabolism
    Atu2745 (acs)
Enzymes [BR:atu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Atu2745 (acs)
Lipid biosynthesis proteins [BR:atu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Atu2745 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 1134783
NCBI-ProteinID: NP_355675
UniProt: Q8UBV5
Position
circular:complement(2742305..2744260)
Genome map
AA seq 651 aa AA seqDB search
MSAKIYPVLKSAKARTLIDNERYQKWYQESVEDPEKFWDKHGRRIDWFKPYTKVKNTSFK
GRVPIKWFEDGLTNVSYNCIDRHLKTHGERTAIIWEGDNPYIDKKITYNQLYDYVCRLAN
VLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPEALAGRIVDCESTF
VITCDEGVRGGKPIPLKENTDKAIDIAAKQYVIVNKVLVVRRTGGKTGWAPGRDIWYHQE
IATVKPDCPPVKMRAEDPLFILYTSGSTGKPKGVLHTTGGYLVYTSMTHEYVFDYKDGEV
FWCTADVGWVTGHSYIVYGPLANCATTLMFEGVPNFPDQGRFWEVIDKHKVNIFYTAPTA
LRSLMGAGDQFVQRSSRESLRLLGTVGEPINPEAWEWYYHVVGEDKSPIVDTWWQTETGG
ILISPLPGATDLKPGSATRPFFGVQPQLVDAEGNVLEGPADGNLCIIDSWPGQSRSVYGD
HQRFVDTYFSTYKGKYFTGDGCRRDEDGYYWITGRVDDVLNVSGHRLGTAEVESALVSHH
QVSEAAVVGYPHPIKGQGIYCYVTLMAGQSGDYALREELVKHVRNEIGPVATPDKIQFAP
GLPKTRSGKIMRRILRKIAEDDFGALGDTSTLADPAVVEDLIANRQNRTAS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaaatctacccggtgctcaaatcggcgaaagcccgcacgctcatcgacaat
gagcgttaccagaaatggtatcaggagagcgtcgaggatccggaaaaattctgggacaag
cacggccggcggatcgactggttcaagccctataccaaggtcaagaacacctcattcaag
gggcgtgtgccgatcaaatggttcgaagacggcctgacgaacgtctcctataactgtatc
gaccggcatttgaagacgcatggcgagcgcacggcgatcatctgggaaggcgacaatccc
tatatcgacaagaagatcacctataaccagctctatgattatgtctgccgtctggccaat
gtgctgaagaagcacggcgttaagaagggtgaccgcgtcaccatctacatgccgatgatt
cccgaggcggcctatgccatgcttgcctgcgcccgcatcggtgccgtgcattccgtcgtc
tttggcggcttctcgcccgaagcgctggccggtcgtatcgttgactgcgaatcgaccttc
gtcatcacctgcgatgaaggcgttcgcggcggcaagccgatcccgctcaaggaaaatacc
gacaaggcgatcgatatcgccgccaagcaatatgtcatcgtcaacaaggttctggtcgtg
cgccgcaccggcggcaagaccggctgggcgccgggccgcgacatctggtatcatcaggaa
attgcgaccgtgaagccggattgcccgccggtgaagatgcgggcggaagatccgctgttc
atcctctacacttcaggctccaccggcaagcccaagggtgtgttgcacaccacgggcggc
tatctcgtctatacgtcgatgacgcatgaatatgtgttcgattacaaggatggtgaagtc
ttctggtgtacggccgatgttggctgggttaccggccattcctacatcgtctacgggcca
ctcgccaattgtgcgacaacgctgatgttcgagggtgttcccaacttcccggatcagggg
cgtttctgggaggtcatcgacaagcacaaggtcaatatcttctataccgcgccgacggcg
ctccgatcgctgatgggggcgggcgaccagttcgttcagcgctcgtcgcgcgaaagcctg
cggcttctcggaacggtgggtgagccgatcaatccggaagcgtgggagtggtattaccat
gtggtcggcgaggacaagagcccgatcgtagacacctggtggcagacggaaacgggcggc
attctcatctcgccgttgccgggtgcgaccgatctgaagccagggtcggcaacaaggccg
ttcttcggcgtgcagccgcagcttgtcgatgccgagggcaatgtgctggaagggccggcg
gacggcaatctctgcatcatcgacagctggccgggccagtcgcggtccgtttatggggat
caccagcgattcgtcgacacctacttctcgacctacaagggcaagtacttcaccggtgac
ggctgccggcgcgacgaggacggttattactggatcacaggtcgcgtcgatgacgtgctc
aacgtctccggccaccgcctaggcacggccgaggtagaatcggcactggtctcgcatcat
caggtttcggaagcggcggtggtcggttatccgcaccccatcaaggggcagggcatttat
tgttatgtcacgctgatggcggggcagagtggcgattatgcgctgcgcgaggagctggta
aagcatgtgcgcaacgagatcggaccggttgcgacgcccgacaagatccagtttgcgccc
ggcctgccgaagacccgctcaggcaagatcatgcggcgcattctgcgcaaaatcgccgag
gacgatttcggtgcgcttggggatacgtcgacgcttgccgatccggcggtggtggaagat
ctcatcgccaaccgccagaaccgcacggcgtcctga

DBGET integrated database retrieval system