KEGG   Agrobacterium fabrum: Atu3723Help
Entry
Atu3723           CDS       T00070                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
atu  Agrobacterium fabrum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:atu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Atu3723 (ruvA)
Enzymes [BR:atu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Atu3723 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(803458..804075)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGSIEEIGADYVLVDVHGVCYVAYCSARTLSKIGSVGEAVVLFIETYVREDQLKL
FGFVSALEREWFNLLQSVQGVGSKVALAVLSTLSPSELANAIALQDKTMISRAPGIGPKV
AVRLVTELRNKAPAFAGDASASIGLKQELGEGVASAPVADAVSALTNLGYSRDQAANAVA
AALKNGGEGGDSAKLIRLGLKELSR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaaaactcaaaggcagcatcgaggaaatcggcgcggattacgtgctggtggat
gtgcatggcgtctgttacgtcgcctattgttcggcgcgcaccttgtcgaaaatcggctcc
gtcggggaagcggttgtcctgttcatcgaaacctatgtgcgtgaagaccagctgaagctg
ttcggctttgtctcggcgctggagcgggaatggttcaatctgctgcaaagcgtgcagggc
gtcggctcgaaagtggcacttgccgttctttccacgctgtcgccttccgaacttgccaat
gcaatagcgctgcaagacaaaaccatgatctcacgcgcgccgggtattggtcccaaggtg
gccgttcgcctcgtgaccgagttgcgcaacaaggcgccagcctttgcgggagacgcttcc
gcttccatcgggctcaagcaggagcttggagagggtgttgcctccgcgccggtcgcggat
gctgtctcagcgctcaccaatctcggctattctcgcgaccaggctgccaatgcggttgcc
gccgcgctgaaaaatggcggggagggcggcgacagcgccaagctcatccggctcggcttg
aaggagctttcgcggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system