KEGG   Agrobacterium fabrum: Atu3778Help
Entry
Atu3778           CDS       T00070                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
atu  Agrobacterium fabrum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Atu3778 (galU)
   00052 Galactose metabolism
    Atu3778 (galU)
   00500 Starch and sucrose metabolism
    Atu3778 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Atu3778 (galU)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Atu3778 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(860825..861712)
Genome map
AA seq 295 aa AA seqDB search
MVEQKKIRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEAAEAGIEHFVFVT
GRGKAVIEDYFDIQFELEQMLRERNKNAELTLLAGLLPKAGTASFTRQQVPLGLGHAVWC
ARDIVGDEPFAVLLPDMIMHSQKSCLKGMVELYDQTQGNVIAVQECAPDQTHKYGIVGVG
NAVGEGFKITEMVEKPAKGTAPSNFYINGRYILQPEIFDILENQERGAGNEIQLTDGMLT
LAKSQEFSGYHFRGQTFDCGAKDGFILANVAFALERGDIRPAIEEPIKALIEGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggtagaacagaagaaaattcggaaggccgtatttccggtcgcaggtctcggtacacgt
ttcctgcccgccaccaaggcagttccgaaagaaatgctcaccgtcgtcgacaagccggtc
attcagtacgttgtcgatgaggcggcggaagcgggtatcgagcattttgtatttgtcacc
ggccgcggcaaggcagtgatcgaagattattttgatattcaatttgaacttgaacagatg
ctgcgcgagcgcaacaagaatgccgagctgacattgctggccggccttctgcccaaggcg
ggcacggcaagcttcacgcgccagcaggtgccgctcggtctcggccatgcggtttggtgt
gcgcgtgatatcgtcggcgatgagccttttgccgtgcttttgcccgacatgatcatgcat
tcgcaaaaaagctgcctgaagggcatggtcgaactttacgaccagacccagggcaacgtc
atcgcggtgcaggaatgcgctcccgaccagacgcataaatatggcattgttggcgtggga
aatgccgtcggcgaaggcttcaagattaccgaaatggtcgaaaagccagccaagggtacg
gcgccgtcgaatttctacatcaacggtcgttatatcctgcagccggaaattttcgatatt
ctcgaaaatcaggaacgcggcgccggtaacgaaatccagttgacggatggcatgctgacg
ctcgccaagtcgcaagaattctccggctatcatttccgtgggcagaccttcgattgcggc
gccaaggatggtttcatcctggcaaacgtcgctttcgcactggagcgcggcgatatccgt
ccggcgatcgaggagccgatcaaggctttgatcgagggtctgaaataa

DBGET integrated database retrieval system