KEGG   Agrobacterium fabrum: Atu3886Help
Entry
Atu3886           CDS       T00070                                 

Gene name
pldB
Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
atu  Agrobacterium fabrum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Atu3886 (pldB)
Enzymes [BR:atu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Atu3886 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(980660..981601)
Genome map
AA seq 313 aa AA seqDB search
MIEATLRASEDNPVPGNQTVGYFTGHGGKQLRYAIFRATRSIARGTVVLLHGRNECIEKY
FETVADLTAMGFWVATFDTRGQGGSERLLKKPGVGHVRRFSDYQRDISLFLEQVVLPDTR
LPFFMIAHSTGALAALAAAPGLSNRIDRLALCSPFIELDSQQSVPRSVIRLVATALSLVG
LGRVQLGRDQRERDFDGNPLTSDARRFARNLTLHRQFPELFIGAPTARWVYEALKTMGRV
TRQDHLTNITVPTLILAPMLDTITPYKAQEELSRNFRAAQLLPITGARHELLHERDVFRK
QALAAIDAFFAPE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagccacattgcgcgccagtgaagacaacccggttcccggcaaccagaccgtc
ggatattttaccggccacggcggcaaacagcttcgttatgcgatctttcgcgccacccgc
tccattgcccgcggaacagtggttctgctgcacggcaggaacgaatgtatcgagaaatat
ttcgaaacggtcgccgatctgacggccatgggcttctgggtcgcgacattcgacacgcgc
gggcagggcggttccgaaaggctcctgaaaaagcccggcgtcgggcatgtgcggcgcttt
tccgattatcagcgcgatatcagcctgtttctcgagcaggttgtcctgccggatacgcgg
ctgcccttcttcatgatcgcccattccaccggcgcgcttgcggccctcgcggccgcgccc
ggcctgtcgaaccggatcgaccgtctggcgctgtgttcgcctttcatcgagctggatagt
cagcaatcggttccacggtccgtcatccggctggttgcgacggccttgagccttgtcggc
ctgggcagggttcagctcggcagggaccagcgcgagcgggatttcgacggcaatccattg
acctcggacgccagacgttttgcaaggaatctgaccctgcaccgacagtttccggaactg
ttcatcggcgcgccgacggcgcgctgggtctatgaagcgctgaagaccatggggcgagtg
acccgccaggatcacctgacgaacatcaccgttccgaccctcattctggcgccgatgctg
gatacgattacgccctataaggcgcaggaagagctttcgcgcaatttccgggcagcacag
cttcttccgataaccggcgcgcgccacgaattgctgcatgagcgcgacgttttccgcaaa
caggcgctggcggccatcgacgcgtttttcgcgccggagtga

DBGET integrated database retrieval system