KEGG   Agrobacterium fabrum: Atu4027Help
Entry
Atu4027           CDS       T00070                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
atu  Agrobacterium fabrum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Atu4027
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Atu4027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1142286..1142786
Genome map
AA seq 166 aa AA seqDB search
MIGELPGVVHRAFCRMSKHALFVVRRRGRCIIRAMISVSKQTAAATAFFLLLAASAFAEG
DAAHGEKVFSRCSTCHSVDAPRTRMGPHLMGVVGRPMAAVADYGHYSQALKDAGAAGRVW
TEDELQKFIASPKKAIPGNAMRFFGLWSETDIVDLIAYLKTHPLPQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgattggcgaattgcccggtgttgttcaccgggcattctgtcgcatgtcaaaacacgcc
ctcttcgttgtcagacggagagggcgttgtattatccgggccatgatttccgtatccaaa
caaactgcggctgcgaccgcgtttttcctcctgcttgcggcaagcgcctttgccgagggc
gatgcggcgcatggcgagaaggttttcagccgctgttccacctgccatagcgtcgatgcg
ccgcgtacccgcatgggaccacatctgatgggcgtggtcggcaggccgatggcggcagtg
gccgattacggccattattcgcaggcgctgaaggatgccggtgcggctggacgggtctgg
acggaagacgagctgcagaaattcattgccagcccgaagaaggcgatccccggaaacgcg
atgcgttttttcgggctgtggagcgaaaccgatattgttgatctgatcgcctatctaaaa
acacatcctctgccgcaataa

DBGET integrated database retrieval system