KEGG   Agrobacterium fabrum: Atu4050Help
Entry
Atu4050           CDS       T00070                                 

Gene name
exoN
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
atu  Agrobacterium fabrum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Atu4050 (exoN)
   00052 Galactose metabolism
    Atu4050 (exoN)
   00500 Starch and sucrose metabolism
    Atu4050 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    Atu4050 (exoN)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Atu4050 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1167226..1168131)
Genome map
AA seq 301 aa AA seqDB search
MDLNRTVRKAVIPVAGNGTRFLPATKAMPKEMLTIVDRPVVQYAVDEAMQAGIEHIIFVT
SRNKTAIEDYFDSAPELINTLTRSGKTVQVLQLEKMLPVAGTVSYTRQQVPLGLGHAVWC
ARELVGKEPFALLLPDMVSYGARGCIAGLMELYDEVGGNILGVEECLPEEVSSYGVVGVG
QKVNHGFSVTEMVEKPEPSKAPSNYYLNGRYILQPEIFDILARQERGAGNEIQLTDGMKR
LAEKQPFHAQKYSGRTFDCGSKQGFIAANVAFSLMRSDMEAQVLASVKELIANHESRVQA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaacagaactgtcagaaaagccgtcattccggtagccggcaacggcacgcgg
tttttgcccgccaccaaggcgatgccaaaggaaatgctgacgatcgtcgatcggccggtc
gtgcaatatgctgtcgacgaggcaatgcaggccggcatcgaacacattattttcgtcacc
agccgcaacaagaccgccatcgaggactatttcgacagcgcacccgaactcatcaacacg
ctcacccgctccggcaagaccgtgcaggtgctgcagctggaaaagatgctgccggttgcc
ggcaccgtcagctatacgcgccagcaggtgccgctcggtctgggccacgccgtctggtgt
gcgcgtgaactggtgggcaaggaacctttcgccctgcttctgcctgatatggtgtcctat
ggtgcgcgcggctgcattgccgggctgatggagctttacgacgaagtcggcggcaatatt
ctcggcgtcgaggaatgcctgccggaagaagtctcgtcctatggcgtggtcggcgtcggg
cagaaggtcaatcacggcttttccgtcactgaaatggtcgagaagccggaaccgtccaag
gcgccttcgaattattacctgaacggccgttatatcctgcagccggaaatcttcgatatt
ctcgccaggcaggaacgcggcgcgggcaatgagattcagttgaccgatggcatgaagcga
cttgctgaaaagcagccgttccacgcgcagaaatattcgggccgcacctttgattgcggc
agcaagcagggcttcatcgccgccaacgtcgccttttcgctgatgcgttcggatatggag
gcccaggtcctcgcttcggtgaaggaactgattgcaaaccacgaaagccgcgtccaggcg
gcctga

DBGET integrated database retrieval system