KEGG   Agrobacterium fabrum: Atu4050Help
Entry
Atu4050           CDS       T00070                                 

Gene name
exoN
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
atu  Agrobacterium fabrum
Pathway
atu00040  Pentose and glucuronate interconversions
atu00052  Galactose metabolism
atu00500  Starch and sucrose metabolism
atu00520  Amino sugar and nucleotide sugar metabolism
atu01100  Metabolic pathways
atu01130  Biosynthesis of antibiotics
Module
atu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Atu4050 (exoN)
   00052 Galactose metabolism
    Atu4050 (exoN)
   00500 Starch and sucrose metabolism
    Atu4050 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    Atu4050 (exoN)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Atu4050 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CoA_binding
Motif
Other DBs
NCBI-GeneID: 1135924
NCBI-ProteinID: NP_356593
UniProt: A9CG00
Position
linear:complement(1167226..1168131)
Genome map
AA seq 301 aa AA seqDB search
MDLNRTVRKAVIPVAGNGTRFLPATKAMPKEMLTIVDRPVVQYAVDEAMQAGIEHIIFVT
SRNKTAIEDYFDSAPELINTLTRSGKTVQVLQLEKMLPVAGTVSYTRQQVPLGLGHAVWC
ARELVGKEPFALLLPDMVSYGARGCIAGLMELYDEVGGNILGVEECLPEEVSSYGVVGVG
QKVNHGFSVTEMVEKPEPSKAPSNYYLNGRYILQPEIFDILARQERGAGNEIQLTDGMKR
LAEKQPFHAQKYSGRTFDCGSKQGFIAANVAFSLMRSDMEAQVLASVKELIANHESRVQA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaacagaactgtcagaaaagccgtcattccggtagccggcaacggcacgcgg
tttttgcccgccaccaaggcgatgccaaaggaaatgctgacgatcgtcgatcggccggtc
gtgcaatatgctgtcgacgaggcaatgcaggccggcatcgaacacattattttcgtcacc
agccgcaacaagaccgccatcgaggactatttcgacagcgcacccgaactcatcaacacg
ctcacccgctccggcaagaccgtgcaggtgctgcagctggaaaagatgctgccggttgcc
ggcaccgtcagctatacgcgccagcaggtgccgctcggtctgggccacgccgtctggtgt
gcgcgtgaactggtgggcaaggaacctttcgccctgcttctgcctgatatggtgtcctat
ggtgcgcgcggctgcattgccgggctgatggagctttacgacgaagtcggcggcaatatt
ctcggcgtcgaggaatgcctgccggaagaagtctcgtcctatggcgtggtcggcgtcggg
cagaaggtcaatcacggcttttccgtcactgaaatggtcgagaagccggaaccgtccaag
gcgccttcgaattattacctgaacggccgttatatcctgcagccggaaatcttcgatatt
ctcgccaggcaggaacgcggcgcgggcaatgagattcagttgaccgatggcatgaagcga
cttgctgaaaagcagccgttccacgcgcagaaatattcgggccgcacctttgattgcggc
agcaagcagggcttcatcgccgccaacgtcgccttttcgctgatgcgttcggatatggag
gcccaggtcctcgcttcggtgaaggaactgattgcaaaccacgaaagccgcgtccaggcg
gcctga

DBGET integrated database retrieval system