KEGG   Agrobacterium fabrum: Atu4289Help
Entry
Atu4289           CDS       T00070                                 

Gene name
adhC
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
atu  Agrobacterium fabrum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Atu4289 (adhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu4289 (adhC)
  Lipid metabolism
   00071 Fatty acid degradation
    Atu4289 (adhC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Atu4289 (adhC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Atu4289 (adhC)
   00626 Naphthalene degradation
    Atu4289 (adhC)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Atu4289 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1412652..1413590)
Genome map
AA seq 312 aa AA seqDB search
MPMALGHEAAGVVEALGEGVRDLEPGDHVVMVFMPSCGHCLPCAEGRPALCEPGAAANAA
GRLLGGATRLNYHGEVVHHHLGVSAFAEYAVVSRNSLVKIDRDLPFVEAALFGCAVLTGV
GAVVNTARVRTGSTAVVIGLGGVGLAAVLGARAAGASKIVAVDLSQEKLALASELGATAI
VNGRDEDAVEQVRELTSGGADYAFEMAGSIRALENAFRMTKRGGTTVTAGLPPPGAALPL
NVVQLVGEERTLKGSYIGTCVPLRDIPRFIALYRDGRLPVNRLLSGRLKLEDINEGFDRL
HDGSAVRQVIEF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccgatggcgctcgggcacgaagcggcgggcgtcgtcgaggcattgggcgaaggcgtg
cgcgatcttgagcccggcgatcatgtggtcatggtcttcatgcccagttgcggacattgc
ctgccctgtgcggaaggcaggcccgctctgtgcgagccgggcgccgccgccaatgcagca
ggcaggctgttgggtggcgccacccgcctgaactatcatggcgaggtcgtccatcatcac
cttggtgtgtcggcctttgccgaatatgccgtggtgtcgcgcaattcgctggtcaagatc
gaccgcgatcttccatttgtcgaggcggcactcttcggctgcgcggttctcaccggcgtc
ggcgccgtcgtgaatacggcaagggtcaggaccggctcgactgcggtcgtcatcggactt
ggcggtgtgggccttgccgcggttctcggagcccgggcggccggtgccagcaagatcgtc
gccgtcgacctttcgcaggaaaagcttgcactcgccagcgaactgggcgcgaccgccatc
gtgaacggacgcgatgaggatgccgtcgagcaggtccgcgagctcacttccggcggtgcc
gattatgccttcgagatggcagggtctattcgcgccctcgaaaacgccttcaggatgacc
aaacgtggcggcaccaccgttaccgccggtctgccaccgccgggtgcggccctgccgctc
aacgtcgtgcagctcgtcggcgaggagcggacactcaagggcagctatatcggcacctgt
gtgcctctccgggatattccgcgcttcatcgccctttatcgcgacggccggttgccggtg
aaccgccttctgagcggaaggctgaagctagaagacatcaatgaagggttcgaccgcctg
cacgacggaagcgccgttcggcaagtcatcgaattctga

DBGET integrated database retrieval system