KEGG   Agrobacterium tumefaciens C58: Atu4289Help
Entry
Atu4289           CDS       T00070                                 

Gene name
adhC
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:atu01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:atu00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:atu00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:atu00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:atu00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:atu00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1412652..1413590)
Genome map
AA seq 312 aa AA seqDB search
MPMALGHEAAGVVEALGEGVRDLEPGDHVVMVFMPSCGHCLPCAEGRPALCEPGAAANAA
GRLLGGATRLNYHGEVVHHHLGVSAFAEYAVVSRNSLVKIDRDLPFVEAALFGCAVLTGV
GAVVNTARVRTGSTAVVIGLGGVGLAAVLGARAAGASKIVAVDLSQEKLALASELGATAI
VNGRDEDAVEQVRELTSGGADYAFEMAGSIRALENAFRMTKRGGTTVTAGLPPPGAALPL
NVVQLVGEERTLKGSYIGTCVPLRDIPRFIALYRDGRLPVNRLLSGRLKLEDINEGFDRL
HDGSAVRQVIEF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccgatggcgctcgggcacgaagcggcgggcgtcgtcgaggcattgggcgaaggcgtg
cgcgatcttgagcccggcgatcatgtggtcatggtcttcatgcccagttgcggacattgc
ctgccctgtgcggaaggcaggcccgctctgtgcgagccgggcgccgccgccaatgcagca
ggcaggctgttgggtggcgccacccgcctgaactatcatggcgaggtcgtccatcatcac
cttggtgtgtcggcctttgccgaatatgccgtggtgtcgcgcaattcgctggtcaagatc
gaccgcgatcttccatttgtcgaggcggcactcttcggctgcgcggttctcaccggcgtc
ggcgccgtcgtgaatacggcaagggtcaggaccggctcgactgcggtcgtcatcggactt
ggcggtgtgggccttgccgcggttctcggagcccgggcggccggtgccagcaagatcgtc
gccgtcgacctttcgcaggaaaagcttgcactcgccagcgaactgggcgcgaccgccatc
gtgaacggacgcgatgaggatgccgtcgagcaggtccgcgagctcacttccggcggtgcc
gattatgccttcgagatggcagggtctattcgcgccctcgaaaacgccttcaggatgacc
aaacgtggcggcaccaccgttaccgccggtctgccaccgccgggtgcggccctgccgctc
aacgtcgtgcagctcgtcggcgaggagcggacactcaagggcagctatatcggcacctgt
gtgcctctccgggatattccgcgcttcatcgccctttatcgcgacggccggttgccggtg
aaccgccttctgagcggaaggctgaagctagaagacatcaatgaagggttcgaccgcctg
cacgacggaagcgccgttcggcaagtcatcgaattctga

DBGET integrated database retrieval system