KEGG   Agrobacterium fabrum: Atu4379Help
Entry
Atu4379           CDS       T00070                                 

Gene name
cy2
Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
atu  Agrobacterium fabrum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Atu4379 (cy2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Atu4379 (cy2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1516948..1517343
Genome map
AA seq 131 aa AA seqDB search
MRNISIIAAAMLAASTVPALSEGDVAKGEAVFKRCSACHAIGEGAKNRVGPQLNGIIGRA
AGGVPDYTYSSAMKKAGEDGLVWTPEELRDFLSAPKKKIPGNKMALAGISKPEDLDNLIA
YIESTASKPAE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatatatcaatcatcgcggcagcgatgctagcggccagcaccgttcccgctctt
tcggagggcgatgttgccaagggggaggcggtcttcaagcgctgttccgcctgtcacgcc
atcggcgagggcgccaaaaaccgggtcggcccgcagcttaacggcatcatcggccgcgca
gcgggcggcgtgcctgattatacttattcgagcgcgatgaaaaaagcgggtgaggacggg
ctcgtctggacgccggaagaattgcgggatttcctgagcgcgccaaagaagaaaataccc
ggaaacaagatggcgctcgccggcatcagtaaaccggaagatctggacaatctcatcgcc
tatatcgagagcacggcttccaagccggctgagtga

DBGET integrated database retrieval system