KEGG   Agrobacterium tumefaciens C58: Atu4483Help
Entry
Atu4483           CDS       T00070                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:atu00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:atu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1628616..1629926
Genome map
AA seq 436 aa AA seqDB search
MSTGFFGDIAKIKYEGPDSTNPLAFRHYNPDEIVGGKRMEDHLRFAVAYWHTFTWPGGDP
FGGQTFQRPWFEDTMQAAKLKADVAFEFFSLLGSPFYCFHDADVRPEGKNFAENTKNLNE
IVDYFAQKQADTGVKLLWGTANLFSNRRFMSGAATNPDPDVFAFSAATVKTCMDATKTLG
GANYVLWGGREGYETLLNTDLSRELDQLGRFLNLVVEYKYKIGFEGTILIEPKPQEPTKH
QYDYDVATVYAFLQKNGLEKEVKVNIEQGHAILAGHSFEHELAMANAFGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFKNGGTNFDSKLRRQSLDPQDLLIGHIGGMD
CCARGLKAAAKMIEDGALSKPLSERYAKWDSPEAQKMLRGELKLEEIAALVERDDINPEP
KPGRQEYLENVVNRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaggcttcttcggcgatatcgccaagatcaaatatgaaggccccgacagcacc
aatccgctggccttccgccattacaatcccgacgagatcgtcggtggcaagcgcatggaa
gatcacctgcgtttcgcggttgcctactggcacaccttcacctggccgggcggtgacccc
ttcggcggccagaccttccagcgcccgtggtttgaagacacgatgcaggctgcgaagctg
aaggcagacgtggccttcgaattcttctcgctgctcggttcgccgttttattgcttccac
gatgcggatgtacgcccggaaggcaaaaacttcgccgagaacaccaagaacctcaacgag
atcgtcgattatttcgcccagaagcaggccgataccggcgtgaagctgctgtggggcacg
gccaacctcttctccaaccggcgtttcatgtcgggtgccgcgaccaatccggacccggat
gtcttcgccttctccgccgcaaccgtgaagacctgcatggacgccaccaagacgctcggc
ggtgccaactacgtgctgtggggcggtcgtgaaggttacgagaccctgctcaacaccgat
ctgtcgcgtgaactcgaccagctcggccgtttcctcaatctggtggtggaatacaaatac
aagatcggtttcgaaggcacgatcctgatcgagccgaagccgcaggagccgaccaagcac
cagtatgattacgacgtcgcgaccgtctatgccttcctgcagaagaatggtctcgaaaag
gaagtgaaggtcaatatcgagcagggccacgccattctcgctggccactccttcgagcat
gaactggccatggccaatgccttcggcattttcggctccatcgacatgaaccgcaacgac
taccagtccggttgggataccgaccagttccccaacaacgtgccggaaatggcgcttgcc
tattaccatgttctcgccggcggcggtttcaagaatggcggcaccaatttcgattccaag
ctgcgtcgccagtcgctcgatccgcaggatctgctgatcggccatatcggcggcatggat
tgctgcgcccgtggcctgaaggcggcggcgaagatgatcgaggacggcgcgctgtcgaag
ccgctttccgagcgttacgcgaagtgggattccccggaagcccagaagatgctgcgcggc
gagctgaagctcgaagagatcgcagcgctggtcgagcgcgacgatatcaatcctgagccg
aagcccggtcgtcaggaatatctcgaaaacgtggtcaatcgttacgtttga

DBGET integrated database retrieval system