KEGG   Agrobacterium tumefaciens C58: Atu4597Help
Entry
Atu4597           CDS       T00070                                 

Definition
ABC transporter permease
Orthology
K02050  
NitT/TauT family transport system permease protein
Organism
atu  Agrobacterium tumefaciens C58
Module
NitT/TauT family transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1743009..1743812)
Genome map
AA seq 267 aa AA seqDB search
MFSKILGAVKGQTHTIGSLVGAGIVWEIAVRALKVPEYILPAPSRVFADLYNNVPVVFTA
SLYTLQPMVLGFLVAVVMGTLLALLVVYSRAFEAIFYPLLVILQIIPKIAIAPLFIIWVG
FGLPSKILLVFLLSFFPIVVNSIVAFKSIEPDVYDLAKSYRAGRLKIFWKVELPGALPSL
FAGFKVAAALSATAAVVAEFVASDNGLGYLLLNYNGNMNTSMTFAVIIVLSLLGLLLYGI
VELIERFAIPWHVSQRREDFTVGKSTT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgaaaatactgggggccgtcaaaggccagacccacacgattggcagcctcgtg
ggcgcagggatcgtgtgggagatcgcggttagggcactcaaggtgccagaatatattctg
ccagctccaagcagagtgtttgcggacctttataacaacgtgccggtggtgttcacggca
tcgctttatacgctgcagccgatggtgctgggctttctggtggcagtggtcatgggaacg
cttcttgcgcttctggtggtctattcgcgagctttcgaggcgatcttttatccgctgctg
gtgatccttcagatcatcccgaagatcgctatcgcaccgctcttcatcatctgggtcggc
ttcggactgccgtccaaaattctgctcgtcttcctgctttcgtttttcccgatcgtcgtc
aactccatcgtggccttcaaatccatcgagccggacgtctacgatctcgccaaaagctat
cgggcgggacgcctgaagattttctggaaggtggaactgcccggtgccctaccctcgctc
tttgcgggtttcaaggtggccgcagcactgtctgcaacagcggcagtcgtggcggagttc
gtcgcctcggacaatgggcttggctacctgctgctcaactacaacggcaacatgaacacc
agcatgacgtttgccgtgatcatcgttctcagcctgcttgggctgcttctctacggcatc
gtggaactgatcgagcgtttcgcgatcccatggcacgtgtcccagcgccgggaggacttc
actgttgggaaaagcacgacctga

DBGET integrated database retrieval system