KEGG   Agrobacterium tumefaciens C58: Atu4665Help
Entry
Atu4665           CDS       T00070                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:atu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:atu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:atu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1823423..1824796
Genome map
AA seq 457 aa AA seqDB search
MARDPKITFIGAGSTVFMKNIIGDVLQRPALSGATIALMDINRERLEESAIVVNKLISTL
GAKAKAETYTDQKKALAGADFVVVAFQIGGYEPCTVTDFEVPRKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDILAVCPNAVMLQYVNPMAINTWAIAEKYPTIRQVGLCHSVQGTA
MELAHDLDIPYEEIRYRSAGINHMAFFLEFEHRQPDGSYRNLYPDLVRGYREGRAPKPGW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGRDDLIEKFGIPLDEYPKRCIEQ
IERWKGQAAAYRSAEKIEVKQSKEYASSIINSVWTGEPSVIYGNQRNNGCITSLPSDCAA
EVPCLVDHNGVQPTFIGELPPQLTALMRTNINVQELTVRALMSENRAHIFHAAMMDPHTA
AELDLDQIWSLVDDLLLAHRDWLPEWTQAEVKRARAV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagatcccaagatcacatttatcggcgcaggctctacggtgttcatgaagaac
atcatcggcgacgtgctgcagcgtccggccctttcgggcgccaccattgcgctgatggac
atcaatcgcgagaggctggaagaaagcgccatcgtcgtcaacaagctgatttcgacattg
ggggcaaaggcgaaagccgagacctataccgaccagaaaaaggcgcttgccggtgccgat
tttgtcgtggtcgccttccagatcggcggatatgaaccctgtacggttaccgatttcgag
gtgccgcgcaaatatggcctgcgccagaccattgccgatacgctcggcgtcggcggcatc
atgcgtggtcttcgcaccgtgccgcatctgtggaaaatctgcgaggatatcctcgccgtc
tgccccaacgccgtcatgctgcaatatgtgaacccgatggcgatcaacacctgggcgatt
gccgagaaatacccgacgatccggcaggttggcctttgccattccgtgcagggcacggcc
atggaactcgcccatgatctcgatatcccttatgaggagatccgctatcgttcggccggc
atcaaccacatggcgtttttcctcgaattcgagcatcgccagcccgacggcagctatagg
aacctctatcccgatctcgtgcgcggctaccgcgaaggccgtgcgccaaaacccggctgg
aacccgcgttgccccaacaaggtgcgttacgagatgctgacgcgactcggttatttcgtc
accgaaagctcggaacatttcgccgaatatacgccctatttcatcaaggaggggcgcgac
gacctgatcgagaaattcggcatcccgctcgatgaatatccgaagcgctgcatcgaacag
atcgagcgctggaaggggcaggcggcggcctatcgttcggccgagaagatcgaggttaag
caatcgaaggaatatgcctcctccatcatcaactccgtctggactggcgaaccctccgtc
atctatggcaaccagcgcaacaacggctgcatcacctcgctcccatcggattgcgcggca
gaagtgccctgccttgtcgaccataacggcgtgcagcccacctttatcggcgaattgccg
ccgcaactcaccgccctgatgcgcaccaacatcaacgtgcaggaactgacggtgcgggcg
ctgatgagcgaaaaccgtgcccatatcttccacgcggcgatgatggacccgcacacggcg
gcggaactggatctcgaccagatatggtcgctggtagacgacctactgctcgcacaccgc
gactggttgccggaatggacgcaggcggaggtgaagcgggcgcgggcggtgtaa

DBGET integrated database retrieval system