KEGG   Agrobacterium tumefaciens C58: Atu4726Help
Entry
Atu4726           CDS       T00070                                 

Gene name
sodBIII
Definition
superoxide dismutase
Orthology
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
atu  Agrobacterium tumefaciens C58
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1889112..1889807
Genome map
AA seq 231 aa AA seqDB search
MDITRRTILTAGAATATVAIFPRPHVAQAALPLTQPKLPFAEADLAPVISARTVGLHYGK
HHKAYFDKLNTLAAGTRYADMELAGIVKESAGSKAAADVKIFNNAAQAWNHVAYWDQFVP
GGPNRPTGDLAASLNETFGDYDGFIKRAVDVSDTVFGTGWVWLTRDDDNKLALIGYEDGN
NPVAVGRPAYLGIDIWEHAYYLDYENRKPDHIRAVLDKLVNWRVVEERLKA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaccagacgcaccattctcaccgccggcgcggcaacagccaccgttgcgatt
tttccccgcccgcatgtcgcgcaggccgcactgcctttgacacagccgaaacttcccttt
gccgaggccgatctggcgcccgttatttcggcaagaacggtcggcctgcattacggaaaa
caccataaggcctatttcgacaagctgaacacgcttgcggccggcacccgctatgccgac
atggagctggccgggatcgtcaaggaatccgccgggtcgaaggcggcggcggatgtcaaa
atcttcaacaatgccgcgcaggcatggaaccatgtcgcctactgggatcaattcgttccg
ggcggaccgaaccggccgacgggtgatctcgctgcttccctcaacgagaccttcggggat
tatgacggtttcatcaaacgcgcggtcgatgtgtccgacacggtgttcggcaccggctgg
gtgtggctgacgcgcgacgacgacaacaagctcgcgctgatcggatatgaggacggcaac
aaccccgtggccgttggccgcccggcctatctcggcatcgatatctgggaacacgcctat
tacctcgattatgaaaaccgcaagcccgaccatatccgcgccgtgctcgacaagctggtc
aactggcgggttgtcgaagagcgcctgaaggcctga

DBGET integrated database retrieval system