KEGG   Agrobacterium fabrum: Atu4799Help
Entry
Atu4799           CDS       T00070                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
atu  Agrobacterium fabrum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Atu4799
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Atu4799
Enzymes [BR:atu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Atu4799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1974870..1975397
Genome map
AA seq 175 aa AA seqDB search
MLFEKTKIEGLLVVNTIPVRDSRGSFARTFCKREFESNALVSDFSQHSLSLSKLKHTIRG
LHFQRPPHQETKLVSCVKGSIWDVAVDLRRGSPTYLQWVGTVLSADNGAQFYIPEGFAHG
FQSLSDDVAVSYLISVPYAEASAAGIRHDEPAIGVEWPAPASVISEKDLGWPAWQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttgagaagacgaagatcgaggggcttttggtcgtcaatacgatacctgtccgg
gacagtcgcggctcgtttgcaaggacattctgcaagcgtgaatttgagagcaacgcgctg
gtgtctgatttcagtcagcacagcctctcgctgtcaaagctcaagcacaccatacgaggg
ttgcatttccagcggccgccgcatcaggagaccaagctggtttcctgcgtcaaagggtcg
atatgggatgtcgccgtcgatctgcgacgcggctcgccgacctatcttcagtgggttggt
acggtgttgtcagccgataatggcgcacagttctacattcccgagggttttgcgcacggt
ttccagtcgctcagcgacgacgtggctgtgtcctatctgatttcggtgccctatgccgag
gcgagcgcggcggggatccgccatgacgaaccggcgatcggtgttgaatggcctgcgcca
gcctccgttatatctgaaaaggatctcggttggccggcctggcaatga

DBGET integrated database retrieval system