KEGG   Agrobacterium tumefaciens C58: Atu4833Help
Entry
Atu4833           CDS       T00070                                 

Gene name
cga
Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:atu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:2012401..2014803
Genome map
AA seq 800 aa AA seqDB search
MRAALDFAPGAPGIDARWTSSAKNGVGTALSNTSPIWFTLSHGILNEVYYPRIDSACIRD
LGLVVTRDDGYFSEEKRDCTSLTQPFESGIPAFHVTNTATDGAYRIEKQVITDPARACVL
LHVSFSPLKGKMGDYRVSVLLAPHLVNAGNLNSAWIGDYEGRRVLFAVGRSRYLALVCDG
PWRAASAGFVGVSDGWQQLRRHGRLIEEFQRADDGNVSLAAEIDFSDAHDTATLALGFGQ
TEYEAASCAVASLKSGFRRAHDAYIANWRGWQDSLCPLDRDTHHGVNSYRVSTAVLAAHR
AADRPGAVVASLSIPWGASKGDDDLGGYHLIWPRDLVEAAGGFLAAGDHDEALAILDYLR
QVQQPSGRWPQNLWLDGKPYWPGVQMDECAFPILLADMLHRHGHLDHAARADYMPMIRSA
AAYILANGPTTGEDRWEEDAGYSPFTLAVEIAALLAAADLLDMEGDAAEATHLRQTADCW
NEQIERWTFAGDQTMCAQLGISGHYVRIASPGTTDAVQLSGMTPILNQTPDRAFLPTSDV
ISPDALALVRFGLRAPDDPHILATVKAIDHCLRAELPQGPVWYRYTGDGYGEHADGTAFD
GTGQGRPWPLLTGERAHYELAAGRRGAAEALLTTMEKSAGQSGLFPEQVWDQPDLPDREL
FYGSPSGSAMPLVWAHAEHIKLLRSLADGSVFDMPPQGVERYIRNKTPSHLRIWCFNNTI
SAMPTGKVLRLELADNAIVHWSADSWATSTDTNTTASGLGTHFADLPVQELAAGGTVVFT
FYWRDAGVWENEDFTVRLGE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgcacttgatttcgcacccggcgcacccggcattgacgcacgctggacgtcg
agcgccaagaatggcgtgggaaccgcgctgtcgaacacctcaccaatctggttcacgctc
agccacggcatcctcaacgaggtctattacccgaggatcgatagtgcctgcatccgcgat
ctcggtcttgtggtcaccagagatgacggatacttttcagaagagaaacgggactgcacc
tcccttacccaacctttcgagagtggaattcccgcgttccacgtcaccaatacggcgaca
gatggagcctatcggattgaaaaacaggtcatcaccgatccggcgcgggcctgtgttctt
ctgcatgtgtccttctcgcccttgaagggaaagatgggggattaccgtgtaagcgttctt
ctggcgccgcatctagtcaatgccggtaatctcaactccgcctggataggggattatgaa
gggcgtcgggtcttgtttgcggtcggccgctcacgatatctcgctctggtctgcgacggt
ccctggcgcgccgcaagtgcgggatttgttggcgtctccgatggctggcaacaattgcgc
cggcacggacgcctcattgaggaattccagcgggcggatgacggcaatgtttcgctggct
gcggaaatcgattttagcgatgcccatgacaccgcgacgttggcgctcggtttcggccag
accgaatatgaagctgcatcctgtgctgtcgcaagtctgaagtccggcttcagacgcgca
cacgatgcctatatcgccaactggcgtggctggcaggacagtctttgccccctcgaccgc
gatacccatcacggcgtcaattcctatcgcgtctcgaccgccgtgcttgccgcgcatcgt
gccgctgaccggcctggagccgtcgtggcgagcctgtcgatcccgtggggagcctccaag
ggcgatgacgatcttggcggatatcatttgatatggccgcgggatctggtggaagccgcc
ggcgggtttctagcggccggtgatcacgatgaggctttggccatccttgattatctgcgc
caggtgcagcaaccctcggggcggtggccgcaaaatctctggctggatggcaagccctat
tggccgggcgttcagatggacgaatgcgcctttccgatcctgcttgcggatatgctgcat
cggcacggccacctcgaccacgccgcaagggcggattacatgccaatgatccgcagcgct
gcggcttatattctggcaaacggcccgacgaccggcgaggacaggtgggaggaagatgca
ggctacagcccgtttacgcttgccgtcgagatcgccgcgctgcttgccgctgctgatctg
ttggatatggagggcgatgcggccgaagccacgcatctgcggcagacagccgattgctgg
aatgagcagatcgaaaggtggacgtttgccggtgaccagaccatgtgcgcgcagcttggt
atttcgggccattatgttcgcatcgcttctcccggtaccaccgatgccgttcagctctcg
ggcatgacgcctatactcaaccagacaccggatcgcgctttcctgccaacaagcgatgtc
atcagccctgatgcacttgcgctggtccgcttcggcctgcgcgcaccggacgatccccac
attctcgcaaccgtcaaggcgatcgatcattgcctgcgcgccgagctgccgcaggggccg
gtctggtacaggtacacgggcgacgggtatggtgagcacgctgatggaacagcatttgac
ggcacgggtcagggcaggccatggccccttctgaccggcgagcgcgcccattacgaactt
gctgcgggcagacgcggggcggcggaagctttgctgaccacaatggaaaaatcggcgggg
cagagcggccttttccccgagcaggtctgggatcaacccgatcttcccgacagggagctg
ttttatggctccccgtcgggcagcgcgatgccgctggtctgggcgcatgcagaacatatc
aagcttctgcgttcgcttgccgatggctccgttttcgacatgccgccgcagggtgtggag
cgctacatccgcaacaagacaccgtcgcatcttcgaatctggtgcttcaacaacacgata
tcagccatgcccaccggcaaggttctgcggcttgaactggcggataatgccatcgtgcac
tggagcgccgacagctgggcgacgagcacagatacaaatacgacggcctccggtctcggc
acgcattttgcggacttgcccgtgcaggaactggcggccggcggcacggtagttttcacc
ttctactggcgagatgctggagtgtgggaaaacgaggactttaccgttcgcctgggcgaa
tga

DBGET integrated database retrieval system