KEGG   Agrobacterium fabrum: Atu4836Help
Entry
Atu4836           CDS       T00070                                 

Definition
(RefSeq) hypothetical protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
atu  Agrobacterium fabrum
Pathway
atu00010  Glycolysis / Gluconeogenesis
atu00520  Amino sugar and nucleotide sugar metabolism
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
atu01200  Carbon metabolism
Module
atu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu4836
   00520 Amino sugar and nucleotide sugar metabolism
    Atu4836
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Atu4836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-GeneID: 1136710
NCBI-ProteinID: NP_355828
UniProt: A9CH74
Structure
PDB: 

Jmol
Position
linear:2017260..2017937
Genome map
AA seq 225 aa AA seqDB search
MAEDQTVLAIDIGGSHVKIGLSTDGEERKVESGKTMTGPEMVAAVTAMAKDMTYDVIAMG
YPGPVVHNKPLREPVNLGEGWVGYDYEGAFGRPVRIVNDALMQAIGSYNGGRMLFLGLGT
GLGAAMIVENVAQPMEIAHLPYRKGKTYEHYVSEAYREKKGNAKWQKRVQDVVERLSAAL
EPDEVVIGGGNVERLENLPPKCRRGDNAMAFEGGFRLWKNADLIV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggatcaaaccgttcttgcaatcgatatcggcggcagtcatgtaaagatcggc
ctgagcacagatggtgaagaacgcaaggttgaaagcggcaagacaatgacgggaccggaa
atggtcgccgccgtaaccgccatggcaaaagatatgacctatgacgtcattgccatggga
tatcccggcccggtcgttcacaacaaaccgcttcgggaaccggtcaatctgggcgaaggc
tgggtcggctatgattatgagggcgctttcggtcgtcccgttcgcatcgtcaacgatgcg
ctcatgcaggcgattggctcttacaacggcggacgcatgttgtttctggggctcggcacg
ggtttgggcgccgcgatgattgtcgaaaacgttgcccagccgatggagatcgcccatctt
ccttatcgcaagggcaaaacctacgagcactatgtcagcgaggcctatcgggaaaagaaa
ggcaacgctaaatggcaaaagcgcgtccaggacgttgtggagcgcctgagcgcggctctt
gaaccggatgaggtcgtcatcggcggcggcaacgtggaaaggctcgaaaatctgccgccg
aagtgcagacgcggagacaacgctatggctttcgaaggcgggttccgcctgtggaagaac
gcggacctcatcgtgtag

DBGET integrated database retrieval system