KEGG   Agrobacterium fabrum: Atu4836Help
Entry
Atu4836           CDS       T00070                                 

Definition
hypothetical protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
atu  Agrobacterium fabrum
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Atu4836
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu4836
   00520 Amino sugar and nucleotide sugar metabolism
    Atu4836
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Atu4836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:2017260..2017937
Genome map
AA seq 225 aa AA seqDB search
MAEDQTVLAIDIGGSHVKIGLSTDGEERKVESGKTMTGPEMVAAVTAMAKDMTYDVIAMG
YPGPVVHNKPLREPVNLGEGWVGYDYEGAFGRPVRIVNDALMQAIGSYNGGRMLFLGLGT
GLGAAMIVENVAQPMEIAHLPYRKGKTYEHYVSEAYREKKGNAKWQKRVQDVVERLSAAL
EPDEVVIGGGNVERLENLPPKCRRGDNAMAFEGGFRLWKNADLIV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggatcaaaccgttcttgcaatcgatatcggcggcagtcatgtaaagatcggc
ctgagcacagatggtgaagaacgcaaggttgaaagcggcaagacaatgacgggaccggaa
atggtcgccgccgtaaccgccatggcaaaagatatgacctatgacgtcattgccatggga
tatcccggcccggtcgttcacaacaaaccgcttcgggaaccggtcaatctgggcgaaggc
tgggtcggctatgattatgagggcgctttcggtcgtcccgttcgcatcgtcaacgatgcg
ctcatgcaggcgattggctcttacaacggcggacgcatgttgtttctggggctcggcacg
ggtttgggcgccgcgatgattgtcgaaaacgttgcccagccgatggagatcgcccatctt
ccttatcgcaagggcaaaacctacgagcactatgtcagcgaggcctatcgggaaaagaaa
ggcaacgctaaatggcaaaagcgcgtccaggacgttgtggagcgcctgagcgcggctctt
gaaccggatgaggtcgtcatcggcggcggcaacgtggaaaggctcgaaaatctgccgccg
aagtgcagacgcggagacaacgctatggctttcgaaggcgggttccgcctgtggaagaac
gcggacctcatcgtgtag

DBGET integrated database retrieval system