KEGG   Agrobacterium fabrum: Atu4847Help
Entry
Atu4847           CDS       T00070                                 

Gene name
rbsk
Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
atu  Agrobacterium fabrum
Pathway
atu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Atu4847 (rbsk)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Atu4847 (rbsk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin HEM4 Aldolase Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 1136721
NCBI-ProteinID: NP_355817
UniProt: A9CH82
Position
linear:2027412..2028350
Genome map
AA seq 312 aa AA seqDB search
MSKKIGVVGSNMVDLITYVDRMPGPGETLEAPTFEMGCGGKGANQAVAAARLGAEVMMVT
RVGDDVFADNTIRNLASFGVDTRHVVKVSGKSSGVAPIFVEQSGENSILIVKGANADLLP
VEVDKAAADLKECGLILMQMEVPVETVYHTIEFAAQNGIETILNPAPAAANLDPERIRQV
TFLVPNESELALLSGLPTDTDEDIVRAARSLIARGIRTVIVTLGARGARMITSDEIVNIE
PVKVTPRDTTGAGDAFIGSFARFYAETREVVSSLKKASLYAAHSITRPGTQKAYASIDEF
EAFCRDHANGAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaaatcggggtcgtcggctccaacatggtcgatcttatcacctatgtggac
cgtatgcctggaccgggcgagacactcgaggcgcccaccttcgaaatggggtgcggcggc
aagggtgccaaccaggcggttgctgcggcgcgacttggtgctgaagtgatgatggtcacc
cgggtcggtgacgatgtcttcgccgataacaccatccgcaacctcgcgagctttggcgtt
gatacgcgtcatgtggtgaaggtttccggcaaatccagcggtgtcgccccgatcttcgtc
gaacaatcgggcgagaattccatcctcatcgtcaaaggagccaatgccgaccttttgcct
gttgaggtcgacaaggcggccgctgatctgaaagagtgcggcctgatcctgatgcagatg
gaagtgccagttgagaccgtctaccatactatcgaatttgcagcccagaacggtatcgag
acgatcctcaatcccgcgcctgccgctgccaatctcgatcctgagcgcatccgccaggta
accttcctcgtaccgaacgagagcgagctcgccttgctgtcggggttgccgaccgacacc
gacgaagacatcgtcagggccgcccgttcgctgatcgcacgcggcattcgcaccgtcatc
gtgaccctgggcgcgcgcggtgcgcgcatgattacgtcagatgaaatcgtcaacatcgag
cccgtcaaggtaacgccgagagacactacgggtgcgggcgatgcctttattggttccttc
gcccgcttttacgccgaaacgcgcgaggtcgtatcctccctgaagaaggcatcgctttac
gcggcgcattccatcacccgtcccggaacacagaaggcctatgccagcatcgacgagttc
gaggcattttgccgcgaccatgccaatggcgcagcctga

DBGET integrated database retrieval system